Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1516 (MJ1516)

Shipped with Ice Packs
In Stock

Description

Overview of MJ1516

MJ1516 is an open reading frame (ORF) encoded in the genome of Methanocaldococcus jannaschii, a microorganism isolated from deep-sea hydrothermal vents . The protein is classified as "uncharacterized," indicating limited functional data. Its UniProt identifier is Q58911, and it spans 99 amino acids based on recombinant production records .

AttributeDetail
Genome ContextPart of the 1.66-Mb circular chromosome of M. jannaschii .
Gene LocusMJ1516 (ordered locus name) .
FunctionUndetermined; potential roles in methanogenesis or metabolic pathways .
Expression HostE. coli .

Recombinant Production and Biochemical Properties

MJ1516 is commercially available as a recombinant protein produced in E. coli. Key production parameters include:

Key Observations

  • Expression System: E. coli is the primary host, with His-tagged versions enabling affinity chromatography purification .

  • Stability: Repeated freeze-thaw cycles are discouraged; working aliquots are stored at 4°C for ≤1 week .

  • Sequence: The full-length amino acid sequence begins with MMAMNEIELMQIKDFVKDMDKNQRIVYYEQKKKSVGIAVLLSFIIPGAGQMYLGRVGKGI... .

Amino Acid Composition and Predicted Features

FeatureDescription
Molecular Weight~11 kDa (calculated from AA sequence) .
HydrophobicityRegions of hydrophobic residues (e.g., LLLT, VLLS) .
Post-Translational ModificationsNo experimentally confirmed modifications reported.

Potential Functional Roles

While MJ1516’s exact role remains unknown, M. jannaschii’s genome encodes proteins involved in:

  • Methanogenesis: Hydrogenase systems and cofactor biosynthesis .

  • Metabolic Pathways: Amino acid biosynthesis, DNA repair, and transcription .

  • Stress Response: Adaptation to extreme temperatures and pressures .

Hypothetical Function: MJ1516 may participate in cofactor metabolism or protein stability under thermophilic conditions.

Research Applications

MJ1516’s recombinant form enables experimental approaches to elucidate its function:

  1. Structural Studies: X-ray crystallography or NMR to resolve tertiary structure.

  2. Interaction Screens: Yeast two-hybrid or affinity chromatography to identify binding partners.

  3. Gene Knockout: Disruption in M. jannaschii to assess phenotypic effects.

Note: No peer-reviewed studies on MJ1516’s function were identified in the literature, highlighting its status as a priority target for functional genomics.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ1516; Uncharacterized protein MJ1516
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1516
Target Protein Sequence
MMAMNEIELMQIKDFVKDMDKNQRIVYYEQKKKSVGIAVLLSFIIPGAGQMYLGRVGKGI ILLLTCWLIIPWIYSIYDAYKSAKDYNAQLYSIIFSKDD
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1516

STRING: 243232.MJ_1516

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for protein research?

Methanocaldococcus jannaschii is a thermophilic methanogenic archaeon that was first isolated from submarine hydrothermal vents at depths of 2600m in the East Pacific Rise. It is a significant organism in scientific research as it was the first archaeon to have its complete genome sequenced, providing crucial insights into archaeal biology and evolution. The organism grows in extreme environments with temperatures ranging from 48-94°C and can only utilize carbon dioxide and hydrogen as primary energy sources for methanogenesis .

M. jannaschii's genome consists of a large circular chromosome that is 1.66 megabase pairs in length with a G+C content of 31.4%, along with additional large and small circular extra-chromosomes . The sequencing of this organism revealed numerous genes unique to the archaeal domain, strengthening the evidence for the three-domain classification of life. The extreme conditions under which this organism thrives make its proteins particularly interesting for studying enzyme evolution, catalytic mechanisms, and potential biotechnological applications .

What is known about uncharacterized protein MJ1516 from M. jannaschii?

As an uncharacterized protein, MJ1516 has limited documented functional information in current research literature. The protein is one of many products encoded in the M. jannaschii genome that was identified during the genome sequencing project led by TIGR (The Institute for Genomic Research) . Like many archaeal proteins, MJ1516 may contain unique structural features that allow it to function in extreme environments. Research approaches for studying this protein would typically involve comparative sequence analysis, structural prediction, recombinant expression, and functional characterization.

What expression systems are suitable for producing recombinant M. jannaschii proteins?

For recombinant expression of M. jannaschii proteins, researchers can employ both heterologous and homologous expression systems:

Heterologous Expression:

  • E. coli systems: Most commonly used, but may require codon optimization and specialized strains for archaeal proteins.

  • Thermophilic expression hosts: Can provide a more compatible environment for proper folding of thermostable proteins.

Homologous Expression:
Recent advancements have made homologous expression in M. jannaschii possible, which may be particularly valuable for uncharacterized proteins like MJ1516. The genetic system developed for M. jannaschii allows for the creation of mevinolin-resistant strains through homologous recombination . A successful example is the homologous overexpression of FprA with an affinity tag, which yielded 0.26 mg of purified protein per liter of culture . This approach may provide more authentic post-translational modifications and proper folding compared to heterologous systems.

What genetic transformation methods work for M. jannaschii?

Transformation of M. jannaschii requires specific techniques adapted to this hyperthermophilic archaeon:

  • Heat shock method: M. jannaschii transformation requires a heat shock treatment rather than chemical methods like polyethylene glycol or liposomes that are used for other methanogens .

  • Linear suicide vectors: For genome modifications, linear forms of suicide vectors are commonly used to avoid integration of the entire vector into the chromosome through single cross-over recombination .

  • Selectable markers: The Psla-hmgA cassette conferring mevinolin/simvastatin resistance serves as an effective selectable marker for transformants .

The transformation process is relatively efficient compared to other methanogens, with colonies forming on solid medium in 3-4 days compared to 7 days for M. maripaludis and 14 days for Methanosarcina species. This efficiency is partly due to M. jannaschii's rapid doubling time of approximately 26 minutes under optimal conditions .

What approaches are most effective for functional characterization of uncharacterized archaeal proteins like MJ1516?

Functional characterization of uncharacterized archaeal proteins requires a multi-faceted approach:

Computational Analysis:

  • Sequence-based predictions: Use of tools like HHpred, BLAST, and profile searches against characterized protein databases

  • Structural predictions: AlphaFold2 or RoseTTAFold for protein structure prediction, especially valuable for archaeal proteins with low sequence similarity to characterized proteins

  • Genomic context analysis: Examination of gene clusters and operonic organization to predict functional relationships

Experimental Approaches:

  • Biochemical assays: Testing predicted activities based on structural features or weak homology

  • Protein interaction studies: Pull-down assays with tagged recombinant protein to identify binding partners

  • Gene knockout/knockdown: Using the genetic system established for M. jannaschii to create deletion strains and observe phenotypic effects

  • High-throughput substrate screening: Testing activity against libraries of potential substrates

  • Crystallography or cryo-EM: Structural determination to identify potential active sites and binding pockets

For thermophilic proteins like those from M. jannaschii, activity assays should be performed at appropriate temperatures (typically 70-85°C) to observe optimal function.

How can I optimize the expression and purification of recombinant MJ1516 for structural studies?

Optimizing expression and purification of M. jannaschii proteins requires addressing challenges specific to hyperthermophilic archaeal proteins:

Expression Optimization:

StrategyImplementationBenefit
Homologous expressionUse of engineered M. jannaschii strains with affinity tag systemsProper folding and post-translational modifications
Codon optimizationAdapting codons to expression hostImproved translation efficiency
Fusion partnersUse of thermostable fusion tagsEnhanced solubility and stability
Temperature inductionLower initial growth with high-temperature inductionBalance between growth and proper protein folding

Purification Strategy:

  • Heat treatment: Exploit the thermostability of M. jannaschii proteins by heating E. coli lysates (70-80°C for 15-30 minutes) to precipitate host proteins while keeping the target protein soluble

  • Affinity tags: The homologous expression system using 3xFLAG-twin Strep tags has been successful for other M. jannaschii proteins, with purification using Streptactin XT superflow columns and elution with 10 mM D-biotin

  • Ion exchange chromatography: Particularly useful as a secondary purification step for thermophilic proteins

  • Size exclusion chromatography: Final polishing step to ensure homogeneity for structural studies

For structural studies, protein stability buffers should be carefully optimized, potentially including osmolytes or stabilizing agents that mimic the native cellular environment of this hyperthermophile.

What are the challenges and solutions for characterizing protein-protein interactions involving MJ1516?

Challenges in Studying M. jannaschii Protein Interactions:

  • Thermophilic nature: Traditional interaction assays may not work at the high temperatures required for physiological relevance

  • Unique archaeal interactome: Potential interaction partners may be novel or uncharacterized

  • Limited in vivo tools: Fewer genetic tools compared to model organisms

  • Structural complexity: Archaeal proteins often have unique folds and interaction surfaces

Methodological Solutions:

  • Thermal-adapted crosslinking: Using thermostable crosslinking reagents that can function at elevated temperatures

  • Pull-down assays with cellular extracts: Using affinity-tagged MJ1516 to identify interaction partners from M. jannaschii lysates prepared under native conditions

  • Bacterial two-hybrid systems: Modified to accommodate thermophilic protein interactions

  • In vitro reconstitution: Testing interactions with purified components at physiological temperatures

  • Homologous tagging: Using the genetic system established for M. jannaschii to create strains expressing tagged versions of MJ1516 for in vivo interaction studies

  • Mass spectrometry identification: Of interaction partners, potentially using chemical crosslinking combined with mass spectrometry (XL-MS)

  • Microscale thermophoresis (MST): For quantitative assessment of protein-protein interactions at high temperatures

A successful example of affinity purification from M. jannaschii is demonstrated with FprA, where Western blot analysis using anti-FLAG antibodies confirmed tag presence, and mass spectrometric analysis identified 41 peptides covering 55% of the protein's primary structure .

How can inteins affect the structure and function of M. jannaschii proteins like MJ1516?

Inteins (internal protein elements) are protein splicing elements that can significantly impact protein structure and function in archaea:

  • Prevalence in M. jannaschii: Proteomic studies have shown that M. jannaschii contains a large number of inteins, with 19 discovered in one study . This high frequency makes it important to consider their potential presence in any uncharacterized protein.

  • Impact on protein expression and purification:

    • Inteins can self-excise during protein maturation

    • Incomplete splicing can result in heterogeneous protein preparations

    • Temperature-dependent splicing kinetics may affect functional studies

  • Experimental considerations:

    • Sequence analysis should include intein prediction tools

    • Expression strategies may need to account for intein splicing requirements

    • Purification protocols should assess splicing efficiency

    • Functional assays should consider the native (post-spliced) form

  • Potential advantages:

    • Inteins can be exploited as tools for protein purification

    • Temperature-dependent splicing can be used for controlled protein activation

    • Understanding intein biology in MJ1516 could provide insights into archaeal post-translational regulation

What bioinformatic approaches can predict potential functions of MJ1516?

Computational Analysis Pipeline for MJ1516:

  • Sequence Analysis:

    • PSI-BLAST searches against characterized protein databases

    • HHpred for sensitive detection of remote homologs

    • Conservation analysis across archaeal species

    • Identification of conserved domains and motifs

  • Structural Prediction:

    • AlphaFold2 or similar tools to predict tertiary structure

    • Structural alignment with characterized proteins in PDB

    • Active site prediction based on structural features

    • Molecular dynamics simulations under high temperature conditions to assess thermostability

  • Genomic Context Analysis:

    • Examination of neighboring genes and operonic structure

    • Comparison of synteny across related species

    • Correlation of presence/absence patterns with metabolic capabilities

  • Integrated Functional Prediction:

    • Metabolic pathway mapping to identify potential gaps filled by MJ1516

    • Co-expression network analysis using transcriptomic data if available

    • Integration of multiple prediction methods using machine learning approaches

This multi-layered approach can provide hypotheses about MJ1516 function that can be tested experimentally, particularly in the context of M. jannaschii's methanogenic and hyperthermophilic lifestyle.

How can I design experiments to test for enzymatic activity of MJ1516?

Experimental Design for Enzymatic Characterization:

  • Hypothesis generation:

    • Use bioinformatic predictions to generate testable hypotheses

    • Consider the metabolic context of M. jannaschii, focusing on methanogenesis, carbon fixation, and adaptation to extreme environments

  • Activity screening approaches:

    • Substrate panels based on predicted function classes

    • High-throughput colorimetric or fluorometric assays adapted for high temperatures

    • Coupled enzyme assays with thermostable coupling enzymes

    • Mass spectrometry-based activity screening

  • Assay conditions optimization:

    • Temperature range testing (optimal around 70-85°C)

    • pH optimization considering intracellular pH of M. jannaschii

    • Buffer compositions that maintain stability at high temperatures

    • Metal ion requirements common in archaeal enzymes

  • Kinetic characterization:

    • Determination of temperature-dependent kinetic parameters

    • Substrate specificity profiling

    • Inhibition studies to confirm active site predictions

  • Validation approaches:

    • Site-directed mutagenesis of predicted catalytic residues

    • Isothermal titration calorimetry for substrate binding analysis

    • Product identification by mass spectrometry or NMR

All enzymatic assays should be conducted with appropriate controls that account for high-temperature effects on assay components and potential spontaneous reactions at elevated temperatures.

What are the best techniques for structural characterization of thermostable proteins like MJ1516?

Structural Biology Approaches for Thermostable Archaeal Proteins:

  • X-ray Crystallography:

    • Advantages: High resolution, well-established methodology

    • Considerations for MJ1516: Thermostable proteins often crystallize more readily; screening should include high-salt conditions that mimic the native environment

    • Approach: Vapor diffusion and microbatch methods with specialized screens for archaeal proteins

  • Cryo-Electron Microscopy (Cryo-EM):

    • Advantages: No crystallization required, can capture multiple conformational states

    • Considerations: Size limitations (typically >100 kDa), though recent advances have improved resolution for smaller proteins

    • Approach: Particularly valuable if MJ1516 forms larger complexes or has flexible domains

  • Nuclear Magnetic Resonance (NMR):

    • Advantages: Solution structure, dynamics information

    • Considerations: Size limitations, but can provide valuable information on protein-substrate interactions

    • Approach: Isotopic labeling (15N, 13C) through recombinant expression in minimal media

  • Small-Angle X-ray Scattering (SAXS):

    • Advantages: Low-resolution envelope, conformational states in solution

    • Considerations: Complements higher-resolution methods

    • Approach: Useful for studying oligomerization states and large-scale conformational changes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Advantages: Probes protein dynamics and solvent accessibility

    • Considerations: Can be performed at various temperatures to understand thermostability

    • Approach: Particularly valuable for mapping binding interfaces and conformational changes

  • Thermal shift assays:

    • Advantages: Rapid assessment of protein stability

    • Considerations: Can be used to screen buffer conditions and ligand binding

    • Approach: Differential scanning fluorimetry with thermostable fluorescent dyes

For MJ1516, a combination of these methods would provide complementary information about its structure, stability, and potential function in the extreme environment where M. jannaschii thrives.

How can contradictions in experimental data about MJ1516 be addressed?

Approaches to Resolve Contradictory Data:

  • Identify sources of experimental variation:

    • Temperature control precision in assays with thermophilic proteins

    • Buffer composition effects on protein stability and activity

    • Expression system artifacts (E. coli vs. homologous expression)

    • Post-translational modifications or processing differences

  • Methodological validation:

    • Cross-validation using orthogonal techniques

    • Replication with standardized protocols

    • Blind testing to eliminate experimenter bias

    • Statistical analysis of reproducibility

  • Biological context considerations:

    • Growth phase or physiological state of M. jannaschii cultures

    • Potential multifunctionality of MJ1516 under different conditions

    • Protein interaction partners that may modify activity

    • Allosteric regulation mechanisms

  • Resolution strategies:

    • Design of critical experiments to directly test contradictory hypotheses

    • Collaboration with laboratories specializing in archaeal biochemistry

    • Development of in vivo validation approaches using the genetic system for M. jannaschii

    • Integration of computational modeling with experimental data

Addressing contradictions in experimental data is particularly important for uncharacterized proteins like MJ1516, where limited prior knowledge means researchers must be especially rigorous in validating new findings and distinguishing genuine functional insights from artifacts.

How can structural insights from MJ1516 inform protein engineering for extreme environments?

Understanding the structural basis of MJ1516's thermostability can provide valuable insights for protein engineering applications:

  • Thermostability determinants:

    • Identification of stabilizing salt bridges, hydrogen bonding networks, and hydrophobic cores

    • Analysis of surface charge distribution patterns specific to thermophilic proteins

    • Quantification of structural rigidity versus flexibility at high temperatures

  • Engineering applications:

    • Design of chimeric proteins incorporating thermostable domains from MJ1516

    • Rational mutagenesis of mesophilic proteins based on MJ1516 structural features

    • Development of thermostable protein scaffolds for industrial applications

  • Experimental approach:

    • Comparative structural analysis between MJ1516 and mesophilic homologs

    • Thermal unfolding studies using circular dichroism and differential scanning calorimetry

    • Site-directed mutagenesis to test the contribution of specific residues to thermostability

    • Molecular dynamics simulations at different temperatures

Proteins from M. jannaschii have shown exceptional enzyme activities at high temperatures, with one example being the FprA protein that demonstrated specific activity of 2,100 μmole/min/mg at 70°C, which was 19-38 times higher than homologs from other methanogenic archaea .

What role might MJ1516 play in the unique metabolism of M. jannaschii?

As an uncharacterized protein, MJ1516 could potentially be involved in several aspects of M. jannaschii's specialized metabolism:

  • Methanogenesis pathway components:

    • M. jannaschii grows exclusively on CO2 and H2 as energy sources

    • MJ1516 could function in electron transfer, CO2 fixation, or methanogenic cofactor biosynthesis

    • Experimental approach: Activity assays with methanogenesis intermediates and complementation studies

  • Adaptation to hydrothermal vent environments:

    • Proteins involved in pressure adaptation, metal resistance, or oxidative stress response

    • Experimental approach: Expression analysis under varying pressure or metal concentrations

  • Novel metabolic pathways:

    • M. jannaschii contains numerous novel biosynthetic pathways for cofactors and amino acids

    • MJ1516 might participate in archaeal-specific metabolic processes

    • Experimental approach: Metabolite profiling in knockout strains, substrate specificity testing

  • Information processing:

    • Potential role in archaeal-specific DNA replication, transcription, or translation

    • M. jannaschii contains archaeal-specific DNA polymerase families

    • Experimental approach: Nucleic acid binding assays, interaction studies with known information processing proteins

The genetic system established for M. jannaschii provides tools for in vivo validation of these hypotheses through targeted gene modifications and phenotypic analysis.

How can advanced microscopy techniques be applied to study MJ1516 localization and dynamics?

Advanced Microscopy Approaches for M. jannaschii Proteins:

  • Challenges in archaeal cell imaging:

    • Small cell size (typical archaeal cells are 0.5-2 μm)

    • Need for specialized high-temperature imaging chambers

    • Requirement for specific fixation protocols for hyperthermophiles

    • Limited availability of archaeal-specific fluorescent probes

  • Methodological solutions:

    • Super-resolution microscopy: Techniques like STED, PALM, or STORM to overcome the diffraction limit for small archaeal cells

    • High-temperature live cell imaging: Specialized chambers that maintain 70-85°C while allowing for imaging

    • Correlative light and electron microscopy (CLEM): Combining fluorescence localization with ultrastructural context

    • Cryo-electron tomography: For high-resolution 3D visualization of MJ1516 in cellular context

  • Protein labeling strategies:

    • Homologous expression of MJ1516 with fluorescent protein tags using the genetic system established for M. jannaschii

    • Click chemistry with unnatural amino acids for minimal perturbation labeling

    • Immunogold labeling for electron microscopy with antibodies against recombinant MJ1516

    • SNAP/CLIP-tag technologies adapted for thermophilic conditions

  • Dynamic studies:

    • Fluorescence recovery after photobleaching (FRAP) for diffusion dynamics

    • Single-molecule tracking at high temperatures

    • Time-lapse imaging during different growth phases or environmental stresses

These advanced microscopy approaches can reveal the subcellular localization, dynamics, and potential interaction partners of MJ1516 in its native cellular environment, providing important clues about its biological function.

What are the most promising future research directions for MJ1516?

The study of uncharacterized proteins like MJ1516 from M. jannaschii represents an important frontier in archaeal biology with several promising research directions:

  • Integration of multi-omics data:

    • Combining transcriptomics, proteomics, and metabolomics to place MJ1516 in a functional context

    • Systems biology approaches to model the role of MJ1516 in M. jannaschii's metabolic network

    • Comparative genomics across diverse archaea to understand evolutionary conservation

  • Advanced structural biology:

    • Time-resolved structural studies to capture conformational dynamics

    • Integrative structural biology combining multiple experimental techniques with computational modeling

    • Investigation of potential post-translational modifications specific to archaea

  • Synthetic biology applications:

    • Utilization of M. jannaschii's genetic system for custom protein production

    • Engineering of chimeric enzymes incorporating thermostable domains from MJ1516

    • Development of archaeal chassis organisms for biotechnology

  • Evolutionary biology insights:

    • Understanding archaeal protein evolution and adaptation to extreme environments

    • Investigation of horizontal gene transfer events involving MJ1516 homologs

    • Reconstruction of ancient protein functions at deep evolutionary branches

The advancement of genetic tools for M. jannaschii has opened new possibilities for in vivo validation of hypotheses regarding uncharacterized proteins, strengthening this organism's position as an important model for studies on archaea, hyperthermophilic metabolism, and evolutionary biology .

How can high-throughput approaches accelerate the characterization of MJ1516 and similar uncharacterized archaeal proteins?

High-throughput Strategies for Archaeal Protein Characterization:

  • Parallel expression and purification:

    • Automated systems for testing multiple expression constructs and conditions

    • Microfluidic platforms adapted for thermophilic protein expression

    • High-throughput purification using different affinity tags and buffer conditions

  • Activity-based protein profiling:

    • Chemical proteomics approaches with activity-based probes

    • Substrate libraries screening using mass spectrometry readouts

    • Microarray-based enzyme substrate screening adapted for high temperatures

  • Structural genomics approaches:

    • Automated crystallization and structure determination pipelines

    • Fragment-based screening for ligand binding sites

    • Integration with computational prediction tools for function annotation

  • Phenotypic screening:

    • CRISPR-based screens in model organisms expressing archaeal proteins

    • Growth-based selection strategies in M. jannaschii using the established genetic system

    • Metabolic profiling of knockout/overexpression strains

  • Data integration and mining:

    • Machine learning approaches to predict protein function from multi-dimensional data

    • Network analysis to place uncharacterized proteins in functional contexts

    • Text mining of scientific literature for hypothesis generation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.