MJ1516 is an open reading frame (ORF) encoded in the genome of Methanocaldococcus jannaschii, a microorganism isolated from deep-sea hydrothermal vents . The protein is classified as "uncharacterized," indicating limited functional data. Its UniProt identifier is Q58911, and it spans 99 amino acids based on recombinant production records .
MJ1516 is commercially available as a recombinant protein produced in E. coli. Key production parameters include:
Expression System: E. coli is the primary host, with His-tagged versions enabling affinity chromatography purification .
Stability: Repeated freeze-thaw cycles are discouraged; working aliquots are stored at 4°C for ≤1 week .
Sequence: The full-length amino acid sequence begins with MMAMNEIELMQIKDFVKDMDKNQRIVYYEQKKKSVGIAVLLSFIIPGAGQMYLGRVGKGI... .
While MJ1516’s exact role remains unknown, M. jannaschii’s genome encodes proteins involved in:
Methanogenesis: Hydrogenase systems and cofactor biosynthesis .
Metabolic Pathways: Amino acid biosynthesis, DNA repair, and transcription .
Stress Response: Adaptation to extreme temperatures and pressures .
Hypothetical Function: MJ1516 may participate in cofactor metabolism or protein stability under thermophilic conditions.
MJ1516’s recombinant form enables experimental approaches to elucidate its function:
Structural Studies: X-ray crystallography or NMR to resolve tertiary structure.
Interaction Screens: Yeast two-hybrid or affinity chromatography to identify binding partners.
Gene Knockout: Disruption in M. jannaschii to assess phenotypic effects.
Note: No peer-reviewed studies on MJ1516’s function were identified in the literature, highlighting its status as a priority target for functional genomics.
KEGG: mja:MJ_1516
STRING: 243232.MJ_1516
Methanocaldococcus jannaschii is a thermophilic methanogenic archaeon that was first isolated from submarine hydrothermal vents at depths of 2600m in the East Pacific Rise. It is a significant organism in scientific research as it was the first archaeon to have its complete genome sequenced, providing crucial insights into archaeal biology and evolution. The organism grows in extreme environments with temperatures ranging from 48-94°C and can only utilize carbon dioxide and hydrogen as primary energy sources for methanogenesis .
M. jannaschii's genome consists of a large circular chromosome that is 1.66 megabase pairs in length with a G+C content of 31.4%, along with additional large and small circular extra-chromosomes . The sequencing of this organism revealed numerous genes unique to the archaeal domain, strengthening the evidence for the three-domain classification of life. The extreme conditions under which this organism thrives make its proteins particularly interesting for studying enzyme evolution, catalytic mechanisms, and potential biotechnological applications .
As an uncharacterized protein, MJ1516 has limited documented functional information in current research literature. The protein is one of many products encoded in the M. jannaschii genome that was identified during the genome sequencing project led by TIGR (The Institute for Genomic Research) . Like many archaeal proteins, MJ1516 may contain unique structural features that allow it to function in extreme environments. Research approaches for studying this protein would typically involve comparative sequence analysis, structural prediction, recombinant expression, and functional characterization.
For recombinant expression of M. jannaschii proteins, researchers can employ both heterologous and homologous expression systems:
Heterologous Expression:
E. coli systems: Most commonly used, but may require codon optimization and specialized strains for archaeal proteins.
Thermophilic expression hosts: Can provide a more compatible environment for proper folding of thermostable proteins.
Homologous Expression:
Recent advancements have made homologous expression in M. jannaschii possible, which may be particularly valuable for uncharacterized proteins like MJ1516. The genetic system developed for M. jannaschii allows for the creation of mevinolin-resistant strains through homologous recombination . A successful example is the homologous overexpression of FprA with an affinity tag, which yielded 0.26 mg of purified protein per liter of culture . This approach may provide more authentic post-translational modifications and proper folding compared to heterologous systems.
Transformation of M. jannaschii requires specific techniques adapted to this hyperthermophilic archaeon:
Heat shock method: M. jannaschii transformation requires a heat shock treatment rather than chemical methods like polyethylene glycol or liposomes that are used for other methanogens .
Linear suicide vectors: For genome modifications, linear forms of suicide vectors are commonly used to avoid integration of the entire vector into the chromosome through single cross-over recombination .
Selectable markers: The Psla-hmgA cassette conferring mevinolin/simvastatin resistance serves as an effective selectable marker for transformants .
The transformation process is relatively efficient compared to other methanogens, with colonies forming on solid medium in 3-4 days compared to 7 days for M. maripaludis and 14 days for Methanosarcina species. This efficiency is partly due to M. jannaschii's rapid doubling time of approximately 26 minutes under optimal conditions .
Functional characterization of uncharacterized archaeal proteins requires a multi-faceted approach:
Computational Analysis:
Sequence-based predictions: Use of tools like HHpred, BLAST, and profile searches against characterized protein databases
Structural predictions: AlphaFold2 or RoseTTAFold for protein structure prediction, especially valuable for archaeal proteins with low sequence similarity to characterized proteins
Genomic context analysis: Examination of gene clusters and operonic organization to predict functional relationships
Experimental Approaches:
Biochemical assays: Testing predicted activities based on structural features or weak homology
Protein interaction studies: Pull-down assays with tagged recombinant protein to identify binding partners
Gene knockout/knockdown: Using the genetic system established for M. jannaschii to create deletion strains and observe phenotypic effects
High-throughput substrate screening: Testing activity against libraries of potential substrates
Crystallography or cryo-EM: Structural determination to identify potential active sites and binding pockets
For thermophilic proteins like those from M. jannaschii, activity assays should be performed at appropriate temperatures (typically 70-85°C) to observe optimal function.
Optimizing expression and purification of M. jannaschii proteins requires addressing challenges specific to hyperthermophilic archaeal proteins:
Expression Optimization:
| Strategy | Implementation | Benefit |
|---|---|---|
| Homologous expression | Use of engineered M. jannaschii strains with affinity tag systems | Proper folding and post-translational modifications |
| Codon optimization | Adapting codons to expression host | Improved translation efficiency |
| Fusion partners | Use of thermostable fusion tags | Enhanced solubility and stability |
| Temperature induction | Lower initial growth with high-temperature induction | Balance between growth and proper protein folding |
Purification Strategy:
Heat treatment: Exploit the thermostability of M. jannaschii proteins by heating E. coli lysates (70-80°C for 15-30 minutes) to precipitate host proteins while keeping the target protein soluble
Affinity tags: The homologous expression system using 3xFLAG-twin Strep tags has been successful for other M. jannaschii proteins, with purification using Streptactin XT superflow columns and elution with 10 mM D-biotin
Ion exchange chromatography: Particularly useful as a secondary purification step for thermophilic proteins
Size exclusion chromatography: Final polishing step to ensure homogeneity for structural studies
For structural studies, protein stability buffers should be carefully optimized, potentially including osmolytes or stabilizing agents that mimic the native cellular environment of this hyperthermophile.
Challenges in Studying M. jannaschii Protein Interactions:
Thermophilic nature: Traditional interaction assays may not work at the high temperatures required for physiological relevance
Unique archaeal interactome: Potential interaction partners may be novel or uncharacterized
Limited in vivo tools: Fewer genetic tools compared to model organisms
Structural complexity: Archaeal proteins often have unique folds and interaction surfaces
Methodological Solutions:
Thermal-adapted crosslinking: Using thermostable crosslinking reagents that can function at elevated temperatures
Pull-down assays with cellular extracts: Using affinity-tagged MJ1516 to identify interaction partners from M. jannaschii lysates prepared under native conditions
Bacterial two-hybrid systems: Modified to accommodate thermophilic protein interactions
In vitro reconstitution: Testing interactions with purified components at physiological temperatures
Homologous tagging: Using the genetic system established for M. jannaschii to create strains expressing tagged versions of MJ1516 for in vivo interaction studies
Mass spectrometry identification: Of interaction partners, potentially using chemical crosslinking combined with mass spectrometry (XL-MS)
Microscale thermophoresis (MST): For quantitative assessment of protein-protein interactions at high temperatures
A successful example of affinity purification from M. jannaschii is demonstrated with FprA, where Western blot analysis using anti-FLAG antibodies confirmed tag presence, and mass spectrometric analysis identified 41 peptides covering 55% of the protein's primary structure .
Inteins (internal protein elements) are protein splicing elements that can significantly impact protein structure and function in archaea:
Prevalence in M. jannaschii: Proteomic studies have shown that M. jannaschii contains a large number of inteins, with 19 discovered in one study . This high frequency makes it important to consider their potential presence in any uncharacterized protein.
Impact on protein expression and purification:
Inteins can self-excise during protein maturation
Incomplete splicing can result in heterogeneous protein preparations
Temperature-dependent splicing kinetics may affect functional studies
Experimental considerations:
Sequence analysis should include intein prediction tools
Expression strategies may need to account for intein splicing requirements
Purification protocols should assess splicing efficiency
Functional assays should consider the native (post-spliced) form
Potential advantages:
Inteins can be exploited as tools for protein purification
Temperature-dependent splicing can be used for controlled protein activation
Understanding intein biology in MJ1516 could provide insights into archaeal post-translational regulation
Computational Analysis Pipeline for MJ1516:
Sequence Analysis:
PSI-BLAST searches against characterized protein databases
HHpred for sensitive detection of remote homologs
Conservation analysis across archaeal species
Identification of conserved domains and motifs
Structural Prediction:
AlphaFold2 or similar tools to predict tertiary structure
Structural alignment with characterized proteins in PDB
Active site prediction based on structural features
Molecular dynamics simulations under high temperature conditions to assess thermostability
Genomic Context Analysis:
Examination of neighboring genes and operonic structure
Comparison of synteny across related species
Correlation of presence/absence patterns with metabolic capabilities
Integrated Functional Prediction:
Metabolic pathway mapping to identify potential gaps filled by MJ1516
Co-expression network analysis using transcriptomic data if available
Integration of multiple prediction methods using machine learning approaches
This multi-layered approach can provide hypotheses about MJ1516 function that can be tested experimentally, particularly in the context of M. jannaschii's methanogenic and hyperthermophilic lifestyle.
Experimental Design for Enzymatic Characterization:
Hypothesis generation:
Use bioinformatic predictions to generate testable hypotheses
Consider the metabolic context of M. jannaschii, focusing on methanogenesis, carbon fixation, and adaptation to extreme environments
Activity screening approaches:
Substrate panels based on predicted function classes
High-throughput colorimetric or fluorometric assays adapted for high temperatures
Coupled enzyme assays with thermostable coupling enzymes
Mass spectrometry-based activity screening
Assay conditions optimization:
Temperature range testing (optimal around 70-85°C)
pH optimization considering intracellular pH of M. jannaschii
Buffer compositions that maintain stability at high temperatures
Metal ion requirements common in archaeal enzymes
Kinetic characterization:
Determination of temperature-dependent kinetic parameters
Substrate specificity profiling
Inhibition studies to confirm active site predictions
Validation approaches:
Site-directed mutagenesis of predicted catalytic residues
Isothermal titration calorimetry for substrate binding analysis
Product identification by mass spectrometry or NMR
All enzymatic assays should be conducted with appropriate controls that account for high-temperature effects on assay components and potential spontaneous reactions at elevated temperatures.
Structural Biology Approaches for Thermostable Archaeal Proteins:
X-ray Crystallography:
Advantages: High resolution, well-established methodology
Considerations for MJ1516: Thermostable proteins often crystallize more readily; screening should include high-salt conditions that mimic the native environment
Approach: Vapor diffusion and microbatch methods with specialized screens for archaeal proteins
Cryo-Electron Microscopy (Cryo-EM):
Advantages: No crystallization required, can capture multiple conformational states
Considerations: Size limitations (typically >100 kDa), though recent advances have improved resolution for smaller proteins
Approach: Particularly valuable if MJ1516 forms larger complexes or has flexible domains
Nuclear Magnetic Resonance (NMR):
Advantages: Solution structure, dynamics information
Considerations: Size limitations, but can provide valuable information on protein-substrate interactions
Approach: Isotopic labeling (15N, 13C) through recombinant expression in minimal media
Small-Angle X-ray Scattering (SAXS):
Advantages: Low-resolution envelope, conformational states in solution
Considerations: Complements higher-resolution methods
Approach: Useful for studying oligomerization states and large-scale conformational changes
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
Advantages: Probes protein dynamics and solvent accessibility
Considerations: Can be performed at various temperatures to understand thermostability
Approach: Particularly valuable for mapping binding interfaces and conformational changes
Thermal shift assays:
Advantages: Rapid assessment of protein stability
Considerations: Can be used to screen buffer conditions and ligand binding
Approach: Differential scanning fluorimetry with thermostable fluorescent dyes
For MJ1516, a combination of these methods would provide complementary information about its structure, stability, and potential function in the extreme environment where M. jannaschii thrives.
Approaches to Resolve Contradictory Data:
Identify sources of experimental variation:
Temperature control precision in assays with thermophilic proteins
Buffer composition effects on protein stability and activity
Expression system artifacts (E. coli vs. homologous expression)
Post-translational modifications or processing differences
Methodological validation:
Cross-validation using orthogonal techniques
Replication with standardized protocols
Blind testing to eliminate experimenter bias
Statistical analysis of reproducibility
Biological context considerations:
Growth phase or physiological state of M. jannaschii cultures
Potential multifunctionality of MJ1516 under different conditions
Protein interaction partners that may modify activity
Allosteric regulation mechanisms
Resolution strategies:
Addressing contradictions in experimental data is particularly important for uncharacterized proteins like MJ1516, where limited prior knowledge means researchers must be especially rigorous in validating new findings and distinguishing genuine functional insights from artifacts.
Understanding the structural basis of MJ1516's thermostability can provide valuable insights for protein engineering applications:
Thermostability determinants:
Identification of stabilizing salt bridges, hydrogen bonding networks, and hydrophobic cores
Analysis of surface charge distribution patterns specific to thermophilic proteins
Quantification of structural rigidity versus flexibility at high temperatures
Engineering applications:
Design of chimeric proteins incorporating thermostable domains from MJ1516
Rational mutagenesis of mesophilic proteins based on MJ1516 structural features
Development of thermostable protein scaffolds for industrial applications
Experimental approach:
Comparative structural analysis between MJ1516 and mesophilic homologs
Thermal unfolding studies using circular dichroism and differential scanning calorimetry
Site-directed mutagenesis to test the contribution of specific residues to thermostability
Molecular dynamics simulations at different temperatures
Proteins from M. jannaschii have shown exceptional enzyme activities at high temperatures, with one example being the FprA protein that demonstrated specific activity of 2,100 μmole/min/mg at 70°C, which was 19-38 times higher than homologs from other methanogenic archaea .
As an uncharacterized protein, MJ1516 could potentially be involved in several aspects of M. jannaschii's specialized metabolism:
Methanogenesis pathway components:
Adaptation to hydrothermal vent environments:
Proteins involved in pressure adaptation, metal resistance, or oxidative stress response
Experimental approach: Expression analysis under varying pressure or metal concentrations
Novel metabolic pathways:
Information processing:
The genetic system established for M. jannaschii provides tools for in vivo validation of these hypotheses through targeted gene modifications and phenotypic analysis.
Advanced Microscopy Approaches for M. jannaschii Proteins:
Challenges in archaeal cell imaging:
Small cell size (typical archaeal cells are 0.5-2 μm)
Need for specialized high-temperature imaging chambers
Requirement for specific fixation protocols for hyperthermophiles
Limited availability of archaeal-specific fluorescent probes
Methodological solutions:
Super-resolution microscopy: Techniques like STED, PALM, or STORM to overcome the diffraction limit for small archaeal cells
High-temperature live cell imaging: Specialized chambers that maintain 70-85°C while allowing for imaging
Correlative light and electron microscopy (CLEM): Combining fluorescence localization with ultrastructural context
Cryo-electron tomography: For high-resolution 3D visualization of MJ1516 in cellular context
Protein labeling strategies:
Homologous expression of MJ1516 with fluorescent protein tags using the genetic system established for M. jannaschii
Click chemistry with unnatural amino acids for minimal perturbation labeling
Immunogold labeling for electron microscopy with antibodies against recombinant MJ1516
SNAP/CLIP-tag technologies adapted for thermophilic conditions
Dynamic studies:
Fluorescence recovery after photobleaching (FRAP) for diffusion dynamics
Single-molecule tracking at high temperatures
Time-lapse imaging during different growth phases or environmental stresses
These advanced microscopy approaches can reveal the subcellular localization, dynamics, and potential interaction partners of MJ1516 in its native cellular environment, providing important clues about its biological function.
The study of uncharacterized proteins like MJ1516 from M. jannaschii represents an important frontier in archaeal biology with several promising research directions:
Integration of multi-omics data:
Combining transcriptomics, proteomics, and metabolomics to place MJ1516 in a functional context
Systems biology approaches to model the role of MJ1516 in M. jannaschii's metabolic network
Comparative genomics across diverse archaea to understand evolutionary conservation
Advanced structural biology:
Time-resolved structural studies to capture conformational dynamics
Integrative structural biology combining multiple experimental techniques with computational modeling
Investigation of potential post-translational modifications specific to archaea
Synthetic biology applications:
Utilization of M. jannaschii's genetic system for custom protein production
Engineering of chimeric enzymes incorporating thermostable domains from MJ1516
Development of archaeal chassis organisms for biotechnology
Evolutionary biology insights:
Understanding archaeal protein evolution and adaptation to extreme environments
Investigation of horizontal gene transfer events involving MJ1516 homologs
Reconstruction of ancient protein functions at deep evolutionary branches
The advancement of genetic tools for M. jannaschii has opened new possibilities for in vivo validation of hypotheses regarding uncharacterized proteins, strengthening this organism's position as an important model for studies on archaea, hyperthermophilic metabolism, and evolutionary biology .
High-throughput Strategies for Archaeal Protein Characterization:
Parallel expression and purification:
Automated systems for testing multiple expression constructs and conditions
Microfluidic platforms adapted for thermophilic protein expression
High-throughput purification using different affinity tags and buffer conditions
Activity-based protein profiling:
Chemical proteomics approaches with activity-based probes
Substrate libraries screening using mass spectrometry readouts
Microarray-based enzyme substrate screening adapted for high temperatures
Structural genomics approaches:
Automated crystallization and structure determination pipelines
Fragment-based screening for ligand binding sites
Integration with computational prediction tools for function annotation
Phenotypic screening:
Data integration and mining:
Machine learning approaches to predict protein function from multi-dimensional data
Network analysis to place uncharacterized proteins in functional contexts
Text mining of scientific literature for hypothesis generation