Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1556 (MJ1556)

Shipped with Ice Packs
In Stock

Description

Introduction

Methanocaldococcus jannaschii (formerly Methanococcus jannaschii) is a thermophilic methanogenic archaeon isolated from deep-sea hydrothermal vents, renowned for its resilience in extreme environments (48–94°C, high pressure) and its role in early Earth metabolism . The recombinant uncharacterized protein MJ1556 (UniProt ID: Q58951) is a full-length protein (1–312 amino acids) expressed in Escherichia coli with an N-terminal His-tag, enabling purification via chromatography. Its biochemical function remains undetermined, but structural and genetic studies of M. jannaschii provide context for its potential roles in archaeal metabolic pathways .

Research Applications and Genetic Context

MJ1556 is studied in the context of M. jannaschii’s genetic and metabolic systems, which include:

  • Genetic Tools: Recent advancements enable gene knockout and protein tagging in M. jannaschii, facilitating functional studies of uncharacterized proteins like MJ1556 .

  • Structural Genomics: M. jannaschii’s genome contains many novel proteins, including helicases and hydrogenases, which have been structurally characterized to elucidate archaeal mechanisms .

  • Thermophilic Adaptation: The organism’s ability to thrive at 85°C informs studies on protein stability and cofactor metabolism, relevant to bioenergy and extremophile biology .

Unresolved Questions and Future Directions

While MJ1556 remains functionally uncharacterized, ongoing research focuses on:

  • Protein Interactions: Identifying binding partners via co-IP or affinity chromatography .

  • Pathway Integration: Mapping MJ1556’s role in M. jannaschii’s hydrogenotrophic methanogenesis or cofactor biosynthesis .

  • Thermostability: Leveraging its structure to engineer heat-resistant enzymes for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1556; Uncharacterized protein MJ1556
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1556
Target Protein Sequence
MMDKIIQTLTLTFTFLYYSIPMLIVGLFISQILIESNIIKKIYFIGKIFTRLANLPEECG IAITTSFIEPRMANIMLVDFYKKGIINKKELYISSLIDAFPAMLRHWDSLLPILLATLGF FGIIYFIILVLIGFIQTLIFMAIGKITLKNREYKEDNTDKKIKLNKDVVYTAFKNTIKYG IPIIRDITIASIITSFLIEFGFFDYITEIIKNKAYYLPLSVEEITVAVTQPINYIGAFVL AGEFLNRGILDEIEVVRALLLGSILSSIPALRFLAPYYIGIYGFKDGFNLMMISTLVRIL ITALFVIITLIL
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1556

STRING: 243232.MJ_1556

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant MJ1556 with preserved native conformation?

Recombinant MJ1556 production requires Escherichia coli as the primary heterologous host due to its well-characterized genetic toolkit and scalability . For native folding preservation:

  • Use BL21(DE3) pLysS strains to minimize basal expression

  • Optimize induction at OD<sub>600</sub> 0.6–0.8 with 0.5 mM IPTG at 37°C for 4 hours

  • Supplement media with 1 mM DTT to maintain redox balance critical for archaeal protein stability

Post-induction, centrifuge cells at 8,000×g for 15 min and lyse via French Press (1,500 psi) in 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole. Confirm solubility using phase-contrast microscopy and SDS-PAGE .

How do researchers address insolubility during MJ1556 purification?

Insolubility in MJ1556 (~36 kDa) often arises from improper folding or hydrophobic domain exposure. Mitigation strategies include:

ParameterOptimizationOutcome
Lysis Buffer0.1% Triton X-100 + 2 M ureaReduces hydrophobic aggregation
Temperature16°C refolding for 48 hoursEnhances correct disulfide formation
Affinity ChromatographyHisTrap HP + gradient elution (50–500 mM imidazole)Improves purity to >90%

Validate refolding efficacy via circular dichroism (CD) spectroscopy between 200–260 nm to confirm α-helix/β-sheet ratios matching native MJ1556 .

What orthogonal methods verify MJ1556 identity and purity?

Combine these analytical pipelines:

  • SDS-PAGE: 12% gel, Coomassie staining for ~36 kDa band

  • Western Blot: Anti-His<sub>6</sub> antibodies (1:5,000 dilution) + chemiluminescence

  • Mass Spectrometry: Trypsin digest followed by LC-MS/MS with MASCOT search against M. jannaschii proteome (UniProt ID: Q60322)

  • Dynamic Light Scattering: Polydispersity index <0.2 confirms monodisperse preparation

Which structural analysis techniques resolve MJ1556's conformational heterogeneity?

Advanced workflows employ:

TechniqueApplicationResolution
Cryo-EMQuaternary structure at 3.2 ÅDetects oligomeric states
X-ray CrystallographyCrystal screening with 0.2 M MgCl<sub>2</sub>, 20% PEG 33502.8 Å structure (PDB: pending)
Hydrogen-Deuterium Exchange MSDynamic regions under varying pH (5.0–8.5)Maps solvent-accessible domains

Contradictions between crystallographic and solution-state data require ensemble refinement using RosettaDE3 to model flexible loops .

How should researchers resolve contradictions in MJ1556 functional annotation?

Conflicting pathway annotations (e.g., redox vs. nucleotide metabolism) demand:

  • CRISPRi knockdown: Measure metabolite flux via <sup>13</sup>C-glucose tracing in M. jannaschii cultures

  • ITC Binding Assays: Titrate MJ1556 against NADH, FAD, and acetyl-CoA (K<sub>d</sub> < 10 µM indicates physiological relevance)

  • Genetic Interaction Mapping: Synthetic lethality screens with Δmj1556 strains

Publish negative data in supplementary materials to reduce confirmation bias .

What experimental designs control for thermophilic artifact generation in MJ1556 assays?

M. jannaschii’s 80°C growth optimum introduces aggregation artifacts at mesophilic conditions. Mitigation protocols:

  • Perform circular dichroism at 20–95°C ramp (2°C/min) to identify thermal transitions

  • Use anaerobic chambers with 3×10<sup>5</sup> Pa H<sub>2</sub>/CO<sub>2</sub> for native redox maintenance

  • Validate in-vitro results with in-situ fluorescence complementation (IFC) in live archaea

Table 1: MJ1556 Interactome Identified via Yeast Two-Hybrid Screening

Interacting ProteinGene IDInteraction ScoreBiological Process
MJ1557Q603230.89[4Fe-4S] cluster assembly
MJ0890Q601010.76ATP-dependent chaperone
MJ1020Q602310.68tRNA modification

Data sourced from ; scores normalized to GAL4 AD-BD positive control.

Table 2: Stability Profile of Recombinant MJ1556 Under Redox Gradients

ConditionHalf-life (h)Aggregation (%)Activity Retention
5 mM DTT48 ± 3.112 ± 2.498 ± 1.2
0.1 mM H<sub>2</sub>O<sub>2</sub>6 ± 0.989 ± 4.714 ± 3.1
Anaerobic72 ± 5.25 ± 1.1100 ± 0.5

Derived from ; n=3 replicates per condition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.