Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1561 (MJ1561)

Shipped with Ice Packs
In Stock

Description

Basic Characterization of MJ1561

MJ1561 is a 553-amino acid protein encoded by the mj1561 gene in Methanocaldococcus jannaschii, a hyperthermophilic methanogenic archaeon . The recombinant version is expressed in E. coli with an N-terminal His tag for purification . Key properties include:

PropertyDetail
Host OrganismMethanocaldococcus jannaschii (DSM 2661 strain)
Recombinant SourceE. coli
TagHis-tag
Protein LengthFull-length (1–553 amino acids)
Catalog Number (Creative BioMart)RFL6380MF

No enzymatic activity, interacting partners, or pathway associations have been experimentally confirmed for MJ1561 to date .

Biological Context of Methanocaldococcus jannaschii

MJ1561 originates from M. jannaschii, a model archaeon studied for its extremophilic adaptations and methane-producing metabolism . Notable features of this organism include:

  • Genome: 1.66 Mbp circular chromosome + two extrachromosomal elements .

  • Metabolism: Obligate hydrogenotrophic methanogen (uses H₂ + CO₂) .

  • Thermostability: Thrives at 85°C and high pressures, making its proteins attractive for structural studies .

Despite extensive metabolic reconstructions (e.g., MJCyc database), MJ1561 is absent from published pathway maps, suggesting it may participate in uncharacterized or non-canonical processes .

Functional Insights

  • Pathway Involvement: MJ1561 is not linked to any known pathways in M. jannaschii, including amino acid biosynthesis, cofactor synthesis, or methanogenesis .

  • Sequence Analysis: The lack of homology to proteins in other archaea or bacteria complicates functional prediction .

Experimental Tools

Genetic systems for M. jannaschii (e.g., gene knockouts, tagged protein expression) have been developed . These could enable:

  • Gene Deletion Studies: To assess MJ1561’s essentiality.

  • Affinity Purification: His-tagged MJ1561 could be isolated for interactome studies .

Comparative Genomic Analysis

The 2023 MJCyc update cataloged 652 functionally annotated proteins in M. jannaschii, yet MJ1561 remains unassigned . This highlights persistent gaps in archaeal proteomics. Key statistics from MJCyc :

CategoryCount
Annotated Enzymes540
Metabolic Reactions883
Pathways142
Uncharacterized Proteins~33% of genome

Future Directions

  1. Structural Studies: Cryo-EM or X-ray crystallography could resolve MJ1561’s tertiary structure, offering clues about its function.

  2. Interaction Screens: Yeast two-hybrid or co-IP assays may identify binding partners .

  3. Transcriptomics: Expression profiling under stress conditions (e.g., nutrient limitation) could reveal regulatory roles.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. For dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We prioritize your specified tag type, if you have one. Please communicate your requirements, and we will make every effort to accommodate them during production.
Synonyms
MJ1561; Uncharacterized protein MJ1561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1561
Target Protein Sequence
MITNKIKIFLISLIFISGVYALQVDAPQYQPNVIHPGDDVDLWIKITNDNYDNEVKNIVV EVSPHYPFELRQVNPIKGKATISHLNPGESDTVYFKLHVDENAPSRDYEIDVKVSYDEIN KEDGKETIHHYEITKIYYLHVYGIASFEINGNFSLIPSKTQTVPIEIINTGTGTAKEVNL YIGYSLNSVNAGSESVEVSAYGTTKTQEKTIYYPTAVPISNLPISPVGETKFYLGALKPD NSRVINLKLYTASNLVEGCYQIPAVITWIDEDGTKRAEQITIGAYVKGDILLGISNVVTD PKEIKPGTTYVRIDVTITNNGHAEAKDVKLKLITNKPFKDSWSNCNIKDVGNLLPGVSKT VSFYVDVDKYASAKHYKLPIEISYLDTANNKYKTEKFIDIYVKPKPLFEIITKEVNVTAG KENTVYITIKNVGSEKAERVKISAIRNSGQPFDYPIKSDTIGTLYPNQTGTGVIVIDVDK NAESKPYIITIEIRCAGDSDEGDNNVYVYQEPLKVVVNNSNSKSYWILGIIVVIAIVLVV GYVFKRKNSKDKE
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1561

STRING: 243232.MJ_1561

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the genomic context of MJ1561 in Methanocaldococcus jannaschii?

Genomic context analysis can provide valuable insights into the potential function of uncharacterized proteins like MJ1561. M. jannaschii was the first archaeon to have its complete genome sequenced, revealing a large circular chromosome of 1.66 megabase pairs with a G+C content of 31.4% . To investigate MJ1561's genomic context, researchers should:

  • Examine genes flanking MJ1561 to identify potential functional relationships or operonic structures

  • Compare the genomic neighborhood with syntenic regions in related methanogens

  • Analyze promoter regions for regulatory elements that might suggest co-regulation with functionally related genes

  • Search for conserved gene clusters across methanogenic archaea that may include MJ1561 homologs

This approach has proven valuable for other M. jannaschii proteins, such as the MJ0438 gene (designated trm14), which was identified as encoding an enzyme responsible for tRNA modification .

What expression systems are recommended for producing recombinant MJ1561?

Several expression strategies have been validated for M. jannaschii proteins:

Heterologous Expression:

  • E. coli expression systems using pET vectors have been successfully employed for M. jannaschii proteins, as demonstrated with the Trm14 protein

  • C-terminal His-tagging facilitates purification via affinity chromatography

  • The PCR-amplified open reading frame can be inserted into vectors like pet22b+ (Novagen) for expression in E. coli

Homologous Expression:

  • A genetic system has been developed specifically for M. jannaschii that enables protein overexpression with affinity tags

  • The suicide vector pDS261 allows for chromosome-based homologous overexpression systems in M. jannaschii

  • This system can incorporate affinity tags such as 3xFLAG-twin Strep tag for detection and purification

When working with hyperthermophilic proteins, consider expression conditions that account for their thermostability and potential codon usage differences.

What transformation methods work for M. jannaschii genetic manipulation?

Transformation of M. jannaschii requires specialized techniques due to its extremophilic nature:

Established Protocol:

  • Grow M. jannaschii cells to mid-log phase (OD600 of 0.5-0.7, corresponding to 2-4 × 10^8 cells/ml)

  • Harvest cells by centrifugation in an anaerobic chamber

  • Resuspend in pre-reduced medium containing sodium sulfide

  • Incubate cells at 4°C for 30 minutes

  • Add linearized plasmid DNA (2 μg) generated by appropriate restriction digestion

  • Incubate at 4°C for an additional hour

  • Subject cells to heat shock at 85°C for 45 seconds

  • Following incubation at 4°C for 10 minutes, add the mixture to pre-reduced medium supplemented with yeast extract

This method typically yields approximately 10^4 transformants per microgram of plasmid DNA , providing sufficient colonies for screening and analysis of genetic modifications.

What approaches can determine the function of uncharacterized protein MJ1561?

Multiple complementary strategies should be employed for functional characterization:

Computational Analysis:

  • Perform sensitive sequence homology searches beyond standard BLAST

  • Predict structural features using AlphaFold or similar tools

  • Analyze domain architecture and conserved motifs

  • Examine genomic context and gene co-occurrence patterns across archaeal species

Biochemical Characterization:

  • Screen for enzymatic activities based on predicted functional domains

  • Develop in vitro assays with potential substrates

  • Use thermal shift assays to identify binding partners or substrates

  • Apply metabolomic profiling to knockout strains if available

Genetic Approaches:

  • Generate a knockout strain using the established genetic system for M. jannaschii

  • Perform complementation studies

  • Create point mutations in conserved residues to probe function

  • Analyze phenotypic changes under various growth conditions

The integration of these approaches has been successful for characterizing other M. jannaschii proteins, including various enzymes involved in RNA modification pathways .

How can protein-protein interactions of MJ1561 be investigated in hyperthermophilic conditions?

Studying protein interactions in hyperthermophiles requires adaptations of standard techniques:

Affinity Purification Methods:

  • Express MJ1561 with an affinity tag using the established M. jannaschii genetic system

  • Perform pull-down experiments under native-like conditions (high temperature, appropriate salt concentration)

  • Use chemical crosslinking to capture transient interactions before cell lysis

  • Analyze co-purifying proteins by mass spectrometry

In Vitro Interaction Studies:

  • Surface plasmon resonance at elevated temperatures

  • Isothermal titration calorimetry with temperature control

  • Size exclusion chromatography of protein mixtures under native conditions

  • Analytical ultracentrifugation to characterize complex formation

In Vivo Approaches:

  • Co-immunoprecipitation using the 3xFLAG-twin Strep tag system established for M. jannaschii

  • Bacterial or yeast two-hybrid systems modified for thermophilic proteins

  • Proximity-dependent labeling techniques adapted for high temperatures

These methods should be performed under conditions that mimic the native environment of M. jannaschii, including elevated temperatures (65-95°C) and appropriate salt concentrations.

What structural biology techniques are most effective for M. jannaschii proteins like MJ1561?

Hyperthermophilic proteins present both challenges and opportunities for structural characterization:

X-ray Crystallography:

  • Thermostable proteins often crystallize more readily due to conformational stability

  • Crystallization may be attempted at elevated temperatures (25-30°C)

  • Consider surface entropy reduction approaches if crystallization proves difficult

  • Perform diffraction experiments at cryogenic temperatures to minimize radiation damage

Cryo-Electron Microscopy:

  • Particularly valuable for larger proteins or complexes

  • Sample preparation should account for the thermophilic nature of the protein

  • Can reveal conformational states relevant to function

Solution-Based Methods:

The inherent stability of thermophilic proteins like those from M. jannaschii can be advantageous for structural studies, potentially resulting in higher resolution structures.

How can post-translational modifications be identified in MJ1561?

Post-translational modifications in archaeal proteins require specialized detection approaches:

Mass Spectrometry-Based Identification:

  • High-resolution tandem mass spectrometry of purified MJ1561

  • Compare protein expressed in native M. jannaschii versus heterologous systems

  • Apply enrichment strategies for specific modifications (phosphorylation, methylation)

  • Use electron-transfer dissociation (ETD) fragmentation to preserve labile modifications

Site-Directed Mutagenesis:

  • Mutate predicted modification sites based on computational analysis

  • Express variants in M. jannaschii using the established genetic system

  • Assess functional impact of mutations through activity assays

Comparative Analysis:

  • Examine known modifications in related archaeal proteins

  • Focus on conserved residues that might be targets for modification

  • Consider archaeal-specific modifications that might not occur in bacterial or eukaryotic systems

M. jannaschii proteins have been shown to contain various post-translational modifications, including RNA-binding proteins with methylation patterns , which could provide insights for MJ1561 characterization.

What are the challenges and solutions for expressing active MJ1561 in heterologous systems?

Expressing hyperthermophilic proteins in mesophilic hosts presents several challenges:

Codon Optimization:

  • M. jannaschii has a low G+C content (31.4%) , requiring codon optimization for expression in E. coli

  • Design synthetic genes with optimized codon usage for the host organism

  • Avoid rare codons that might cause translational pausing

Folding Considerations:

  • Express at elevated temperatures (30-37°C) to promote proper folding

  • Co-express with molecular chaperones from thermophilic organisms

  • Consider using cold-shock promoters for slow, controlled expression

Solubility Enhancement:

  • Use solubility-enhancing fusion partners (MBP, SUMO, etc.)

  • Optimize buffer conditions with osmolytes or stabilizing agents

  • Perform refolding from inclusion bodies using temperature-controlled protocols

Activity Verification:

  • Compare activity of protein expressed in E. coli versus native M. jannaschii

  • Assess thermal stability using differential scanning calorimetry

  • Verify correct folding using circular dichroism spectroscopy

Successful heterologous expression has been demonstrated for other M. jannaschii proteins, such as Trm14, using E. coli expression systems with C-terminal His-tags .

What genetic tools are available for manipulating the MJ1561 gene in M. jannaschii?

Recent developments have established genetic systems for M. jannaschii:

Transformation System:

  • A transformation protocol using heat shock has been established for M. jannaschii

  • The method yields approximately 10^4 transformants per microgram of plasmid DNA

  • No chemical treatment (such as CaCl₂ or PEG) is required, unlike systems for other archaea

Vector Systems:

  • Suicide vectors like pDS210 and pDS261 have been developed for M. jannaschii

  • These plasmids can be used for gene knockouts and chromosome-based homologous overexpression

  • The vectors incorporate selectable markers such as mevinolin resistance

Expression Control:

  • Engineered promoters such as P* have been developed for controlled expression

  • The system allows for incorporation of affinity tags for protein detection and purification

This genetic toolkit enables various manipulations of M. jannaschii genes, including targeted modifications of MJ1561 for functional studies.

Genetic ToolApplicationEfficiencyReference
pDS210 vectorMevinolin resistance marker10^4 colonies/μg DNA
pDS261 vectorHomologous overexpression5×10^3 colonies/μg DNA
Heat shock transformationDNA deliveryNo chemical treatment required
P* promoterControlled gene expressionEngineered from native promoters
3xFLAG-twin Strep tagProtein detection and purificationCompatible with M. jannaschii

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.