Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1566 (MJ1566)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MJ1566; Uncharacterized protein MJ1566
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1566
Target Protein Sequence
MGFKYLKIKNPKVILTEWIPFGKNYMTEFIDRITLKEYQRKRIKYFTASERRDIRYKAVF ETSEYQTTVNIIEFIPETSVKFTAEIIGERKKDVFIYVDYLGRCIYSSEITKAGDEEEIV SLDNLSFVIPDLILDSSRIMSHLISPPQRYLLETLYGEIKVYKHVTVLTETVVNIDENTI LEISQVIGAVKNIIEIDDGLIIFGDFGIFISHKNPEKFEKFIYYYPFIRSITGVSRDLFF KLNNIASKLEVISNTLASGVDLEDITEIRGELSRIDRELAVIEIVCGYLKEIVEFLNSSY PPNFGDFDLMILEKVEAERKLRRLIYRIAEIENILKSNDSLATSLTRLLTTISEDLERKI ANQLAENTKYQVAIGEAMEVLEIGIFGVYALEAAHILLLTSGKDEILHHIKILGFPLEFW IILVVTILGVYVGKIVIEYRKKKVLGE
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1566

STRING: 243232.MJ_1566

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ1566 and why is it of research interest?

MJ1566 is an uncharacterized protein from Methanocaldococcus jannaschii, a thermophilic methanogenic archaeon. This protein is of particular research interest because it comes from an organism that was the first archaeon to have its complete genome sequenced, revealing many genes unique to the archaea domain . As an uncharacterized protein, MJ1566 represents an opportunity to potentially discover novel protein functions, particularly those that may be adapted to extreme environments. The protein consists of 447 amino acids and is available as a recombinant protein with a His-tag expressed in E. coli . Studying MJ1566 may contribute to our understanding of archaeal biology, protein evolution, and potentially reveal enzymes with biotechnological applications suited to high-temperature conditions.

What is known about the source organism Methanocaldococcus jannaschii?

Methanocaldococcus jannaschii is a thermophilic methanogenic archaeon isolated from a submarine hydrothermal vent at a depth of 2600 meters near the western coast of Mexico . This extremophile thrives in remarkable conditions:

  • Temperature range: 48-94°C, with optimal growth around 85°C

  • Can withstand pressures up to more than 500 atmospheres

  • Tolerates moderate salinity

  • Grows autotrophically, using only carbon dioxide and hydrogen as primary energy sources

  • Produces methane as a metabolic byproduct

  • Contains a large number of inteins (19 identified in one study)

M. jannaschii's genome consists of three distinct elements: a large circular chromosome (1.66 megabase pairs) with a G+C content of 31.4%, plus large and small circular extrachromosomal elements . The genome sequencing project identified 1738 predicted protein-coding genes , many of which remain uncharacterized, including MJ1566.

How does the structure of the M. jannaschii genome inform our understanding of MJ1566?

The M. jannaschii genome provides critical context for understanding MJ1566. The complete 1.66-megabase pair genome sequence has been determined along with its 58- and 16-kilobase pair extrachromosomal elements . Analysis of the genome structure can provide insights into MJ1566's potential function through:

  • Genomic context analysis - Examining neighboring genes can suggest potential functional relationships, as genes involved in the same pathway are often clustered together in prokaryotic genomes.

  • Promoter region analysis - Identifying regulatory elements upstream of the MJ1566 gene can indicate conditions under which the gene is expressed.

  • Comparative genomics - Analyzing the presence or absence of MJ1566 homologs across other archaeal species can suggest its evolutionary significance.

  • Operon structure - Determining if MJ1566 is part of an operon can provide functional context, as co-transcribed genes often participate in related cellular processes.

The genomic sequence information (SEQ ID NO: 1, 2, or 3) and the identified ORFs described in the patent literature form the basis for isolating and studying the MJ1566 gene . This sequence data enables the design of primers for PCR amplification and cloning of the MJ1566 gene from genomic DNA libraries.

What are the optimal expression systems for recombinant production of MJ1566?

For recombinant production of MJ1566, researchers should consider several expression systems, each with distinct advantages for archaeal protein production:

E. coli Expression System:

  • Most commonly used for initial protein production attempts

  • Available as His-tagged recombinant protein produced in E. coli

  • Advantages: Rapid growth, high yields, well-established protocols

  • Challenges: Potential folding issues with archaeal proteins, lack of archaeal-specific post-translational modifications

Archaeal Expression Hosts:

  • Thermococcus kodakarensis or Sulfolobus species as archaeal expression hosts

  • Advantages: Native-like environment, proper folding at high temperatures, archaeal-specific chaperones

  • Challenges: Slower growth, lower yields, less developed genetic tools

Cell-Free Expression Systems:

  • Using archaeal extracts for cell-free protein synthesis

  • Advantages: Rapid production, ability to express toxic proteins, direct incorporation of labeled amino acids

  • Challenges: Lower yields, higher costs, technical complexity

For optimal expression, consider these methodological approaches:

  • Use codon-optimized sequences for the chosen expression host

  • Include solubility tags (MBP, SUMO) in addition to His-tag for improved solubility

  • Employ temperature-controlled expression protocols (e.g., cold shock for E. coli)

  • Test multiple promoter systems to optimize expression levels

  • Incorporate chaperone co-expression to assist proper folding

The choice of expression system should align with specific research goals - use E. coli for initial structural studies and archaeal hosts when native activity and folding are critical.

What purification strategies are most effective for recombinant MJ1566?

Purification of recombinant MJ1566 can be approached through a multi-step strategy tailored to its biochemical properties and the presence of affinity tags:

Initial Affinity Chromatography:

  • For His-tagged MJ1566, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Buffer considerations: Include low concentrations of imidazole (10-20 mM) to reduce non-specific binding

  • Temperature considerations: Perform at room temperature to balance protein stability and binding efficiency

Secondary Purification Steps:

  • Ion exchange chromatography based on predicted pI of MJ1566

  • Size exclusion chromatography for final polishing and buffer exchange

  • Hydrophobic interaction chromatography if the protein has exposed hydrophobic patches

Thermostability Exploitation:

  • Heat treatment step (60-70°C for 10-20 minutes) to precipitate host proteins while retaining thermostable MJ1566

  • This step can significantly increase purity when using mesophilic expression hosts like E. coli

Quality Control Assessments:

  • SDS-PAGE with Coomassie and silver staining to assess purity

  • Western blot using anti-His antibodies to confirm identity

  • Mass spectrometry for accurate molecular weight determination and sequence verification

  • Dynamic light scattering to evaluate homogeneity and aggregation state

A methodical purification table should document conditions at each step:

Purification StepBuffer CompositionTemperatureFlow RateElution ConditionsExpected Yield
IMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-500 mM imidazole25°C1 ml/minImidazole gradient70-80%
Heat treatment50 mM Tris-HCl pH 8.0, 150 mM NaCl65°C, 15 minN/AN/A60-70%
Size exclusion20 mM HEPES pH 7.5, 150 mM NaCl4-25°C0.5 ml/minIsocratic85-95%

Proper storage conditions (-80°C in 20% glycerol) should be established empirically to maintain protein stability for long-term studies.

How can researchers assess the thermostability of MJ1566?

Assessing the thermostability of MJ1566 is crucial given its origin from a hyperthermophilic organism that thrives in temperatures up to 94°C . Multiple complementary techniques should be employed:

Differential Scanning Calorimetry (DSC):

  • Directly measures the heat capacity of the protein as a function of temperature

  • Provides thermodynamic parameters: melting temperature (Tm), enthalpy change (ΔH), heat capacity change (ΔCp)

  • Experimental design: Temperature ramp from 25°C to 110°C with protein concentration of 0.5-1 mg/ml

Circular Dichroism (CD) Spectroscopy:

  • Monitors temperature-dependent changes in secondary structure

  • Perform thermal denaturation curves by following ellipticity at 222 nm (for α-helices) or 218 nm (for β-sheets)

  • Temperature range should extend from 25°C to at least 95°C to cover M. jannaschii's native growth conditions

Thermal Shift Assays (TSA)/Differential Scanning Fluorimetry:

  • High-throughput method using fluorescent dyes (SYPRO Orange)

  • Monitors protein unfolding through exposure of hydrophobic residues

  • Particularly useful for screening buffer conditions that enhance thermostability

Activity-Based Thermal Stability:

  • Once enzymatic function is identified, measure residual activity after incubation at various temperatures

  • Incubate protein aliquots at temperatures from 60-100°C for defined time periods (e.g., 0, 15, 30, 60 minutes)

  • Plot residual activity versus incubation temperature to determine half-life at each temperature

Comparative Analysis:
Compare MJ1566 stability parameters with other characterized proteins from M. jannaschii to contextualize results within the organism's proteome. Researchers should document stability data in standardized formats:

MethodParameter MeasuredValue for MJ1566Comparison with Mesophilic Homologs
DSCMelting temperature (Tm)(to be determined)Typically 20-40°C higher
CDTemperature of 50% unfolding(to be determined)More cooperative unfolding
TSATm in various buffers(to be determined)Less affected by buffer conditions
ActivityHalf-life at 80°C(to be determined)Orders of magnitude longer

These thermostability measurements will be essential for establishing optimal handling, storage, and experimental conditions for functional studies of MJ1566.

What bioinformatic approaches can predict potential functions of MJ1566?

Predicting the function of uncharacterized proteins like MJ1566 requires a multi-layered bioinformatic approach:

Sequence-Based Analysis:

  • BLAST searches against non-redundant protein databases to identify homologs

  • Multiple sequence alignments to identify conserved residues suggestive of functional sites

  • Domain and motif identification using databases like Pfam, PROSITE, and InterPro

  • Secondary structure prediction using algorithms like PSIPRED and JPred

  • Detection of signal peptides and transmembrane regions using SignalP and TMHMM

Structural Analysis:

  • Homology modeling based on structurally characterized proteins with similar sequences

  • Threading approaches for remote homology detection when sequence identity is low

  • Ab initio structure prediction using methods like AlphaFold2 or RoseTTAFold

  • Identification of potential ligand-binding pockets using CASTp or COACH

  • Electrostatic surface analysis to identify potential nucleic acid or protein interaction regions

Genomic Context Analysis:

  • Examination of neighboring genes in the M. jannaschii genome for functional associations

  • Analysis of gene clusters across archaeal species using tools like STRING

  • Identification of conserved operons that might suggest functional relationships

  • Phylogenetic profiling to identify co-evolutionary patterns with other proteins

Integrative Approaches:

  • Protein-protein interaction predictions using computational methods

  • Metabolic pathway gap analysis to identify missing enzymes in M. jannaschii

  • Gene expression correlation analysis if transcriptomic data is available

  • Comparison with experimentally characterized proteins from other extremophiles

The predictions should be organized systematically for hypothesis generation:

Analysis MethodPrediction for MJ1566Confidence ScoreExperimental Validation Approach
Sequence homology(To be determined)Low/Medium/HighTargeted biochemical assays
Domain prediction(To be determined)Low/Medium/HighTruncation studies
Structural modeling(To be determined)Low/Medium/HighCrystallography or cryo-EM
Genomic context(To be determined)Low/Medium/HighGene knockout studies

These bioinformatic predictions should direct subsequent experimental approaches rather than be considered definitive functional assignments.

What techniques are most effective for determining protein-protein interactions involving MJ1566?

Investigating protein-protein interactions (PPIs) involving MJ1566 requires techniques appropriate for thermostable archaeal proteins:

In Vitro Approaches:

  • Pull-down Assays:

    • Immobilize purified His-tagged MJ1566 on Ni-NTA resin

    • Incubate with M. jannaschii cell lysate prepared under native conditions

    • Elute and identify binding partners via mass spectrometry

    • Critical control: Perform parallel experiments with unrelated His-tagged proteins

  • Surface Plasmon Resonance (SPR):

    • Immobilize MJ1566 on a sensor chip

    • Flow potential binding partners over the surface

    • Measure real-time association and dissociation kinetics

    • Advantage: Provides quantitative binding constants

  • Thermal Shift Assays for Complex Formation:

    • Measure MJ1566 thermal stability alone and in the presence of potential binding partners

    • Increased stability often indicates complex formation

    • Suitable for thermostable proteins and high-throughput screening

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • Particularly valuable for thermophilic proteins where interactions may be entropy-driven

    • Provides stoichiometry, binding constants, enthalpy, and entropy changes

In Vivo and In Situ Approaches:

  • Bacterial Two-Hybrid Systems:

    • Adapt for high-temperature conditions if using thermophilic host

    • Use specialized vectors for archaeal protein expression

    • Monitor protein interactions through reporter gene activation

  • Co-immunoprecipitation:

    • Generate antibodies against MJ1566 or use anti-tag antibodies

    • Precipitate from M. jannaschii lysate under native conditions

    • Identify co-precipitating proteins via mass spectrometry

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse MJ1566 to a biotin ligase

    • Express in a suitable host (possibly a thermophilic archaeon)

    • Identify biotinylated proteins in proximity to MJ1566

  • Crosslinking Mass Spectrometry:

    • Use thermostable crosslinkers compatible with high temperatures

    • Apply to purified complexes or whole cell lysates

    • Identify interaction interfaces through mass spectrometry

Data Integration and Validation:

TechniqueAdvantagesLimitationsTemperature CompatibilityRequired Controls
Pull-downSimple setupNon-specific bindingModerateUnrelated His-tagged protein
SPRReal-time kineticsSurface immobilization effectsHighReference cell surface
ITCComplete thermodynamic profileHigh protein consumptionVery highBuffer mismatch control
Two-hybridIn vivo detectionPotential false positivesLimitedEmpty vector controls

Researchers should employ multiple complementary techniques, as each has distinct strengths and limitations. Validation of key interactions should include reciprocal pull-downs and functional assays to establish biological relevance.

How can researchers identify potential enzymatic activities of MJ1566?

Determining the enzymatic function of an uncharacterized protein like MJ1566 requires a systematic activity screening approach:

Activity Prediction-Based Screening:

  • Targeted Assays Based on Bioinformatic Predictions:

    • Design specific activity assays based on predicted protein families, domains, or structural similarities

    • Test substrates relevant to M. jannaschii metabolism, particularly those involved in methanogenesis or carbon dioxide fixation

    • Consider the organism's preference for carbon dioxide and hydrogen as primary energy sources

  • Enzymatic Activity Screening Panels:

    • Test against panels of substrates for common enzyme classes (hydrolases, transferases, oxidoreductases)

    • Screen at multiple temperatures (room temperature, 60°C, 80°C) reflecting both experimental convenience and native conditions

    • Utilize coupled enzyme assays for detecting activity where direct measurement is challenging

Untargeted Approaches:

  • Metabolite Profiling:

    • Express MJ1566 in a heterologous host and analyze changes in metabolome

    • Compare metabolic profiles of wild-type and MJ1566-overexpressing cells

    • Identify accumulated or depleted metabolites suggesting enzymatic activity

  • Substrate Screening by Differential Scanning Fluorimetry:

    • Test thermal stability shifts upon addition of diverse metabolites and cofactors

    • Increased stability often indicates binding, suggesting potential substrates

    • High-throughput method compatible with compound libraries

  • Activity-Based Protein Profiling:

    • Use chemical probes designed to react with specific enzyme classes

    • Apply to purified MJ1566 or cellular extracts expressing the protein

    • Identify activity through probe labeling detected by gel or mass spectrometry

Experimental Considerations for Thermostable Enzymes:

ParameterConsiderations for MJ1566Methodological Impact
TemperatureTest range from 60-90°CUse thermostable assay components
pHTest range from pH 5-9Account for pH shifts at high temperatures
Buffer stabilityAvoid temperature-sensitive buffersUse HEPES or phosphate buffers
Metal cofactorsInclude panel of divalent metalsConsider metal chelation controls
Redox conditionsTest both reducing and oxidizingUse oxygen-free conditions if needed

Validation Approaches:

  • Site-directed mutagenesis of predicted catalytic residues to confirm mechanism

  • Determination of kinetic parameters (Km, kcat, substrate specificity)

  • Structural studies of enzyme-substrate complexes

  • Complementation studies in model organisms with known enzymatic deficiencies

  • Comparative analysis with characterized enzymes from related archaea

The high temperature optimum of M. jannaschii (85°C) means that conventional enzyme assays may need modification, including thermostable detection reagents and real-time monitoring systems capable of high-temperature operation.

How might structural biology approaches be optimized for MJ1566 characterization?

Structural characterization of MJ1566 presents both challenges and opportunities due to its archaeal origin and thermostable nature:

X-ray Crystallography Optimization:

  • Crystallization Screening:

    • Employ specialized screens designed for thermostable proteins

    • Test crystallization at multiple temperatures (4°C, 20°C, and 37°C)

    • Include archaeal-specific additives like inorganic salts at high concentrations

    • Consider in situ proteolysis to remove flexible regions that might hinder crystallization

  • Protein Engineering for Crystallization:

    • Design surface entropy reduction mutations to create crystal contacts

    • Create fusion constructs with crystallization chaperones (T4 lysozyme, BRIL)

    • Generate truncated constructs based on predicted domain boundaries

    • Consider heavy atom derivatives for phasing if molecular replacement fails

Cryo-Electron Microscopy (Cryo-EM) Approaches:

  • Sample Preparation:

    • Optimize grid preparation protocols for thermostable proteins

    • Test detergent additives to break preferred orientations

    • Consider GraFix method to stabilize potential complexes

  • Data Collection Strategy:

    • Collect data at multiple defocus values

    • Implement energy filters to improve signal-to-noise ratio

    • Consider tilted data collection to overcome preferred orientations

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Sample Optimization:

    • Prepare isotopically labeled protein (13C, 15N) in E. coli expression systems

    • Test stability at elevated temperatures compatible with NMR experiments

    • Optimize buffer conditions to minimize line broadening

  • Experimental Design:

    • Perform temperature-dependent studies to correlate structure with stability

    • Consider selective labeling strategies for larger proteins

    • Implement TROSY techniques for larger proteins or complexes

Integrated Structural Biology Approach:

MethodResolution RangeSample RequirementsAdvantages for MJ1566Challenges
X-ray crystallography1-3 ÅCrystals, mg quantitiesAtomic detail of catalytic sitesCrystallization of thermostable proteins
Cryo-EM2.5-4 ŵg quantities, no crystalsNo crystallization neededPreferred orientations
NMRN/A (atomic)Soluble, stable at >500 µMDynamic informationSize limitations
Small-angle X-ray scattering10-20 ÅMonodisperse sampleLow-resolution envelopeLimited resolution

Structure-Function Analysis:

  • Identify potential catalytic residues through structural analysis

  • Map sequence conservation onto structure to identify functional hotspots

  • Perform computational docking studies with predicted substrates

  • Use molecular dynamics simulations at elevated temperatures to understand thermal stability mechanisms

The structural data should be deposited in appropriate databases (PDB, EMDB) with comprehensive metadata including experimental conditions optimized for this thermostable protein.

What considerations are important for genetic manipulation studies of MJ1566 in M. jannaschii?

Genetic manipulation of M. jannaschii to study MJ1566 function presents significant challenges due to the extremophilic nature of the organism and limited genetic tools available:

Technical Challenges and Solutions:

  • Transformation Methods:

    • Develop high-pressure transformation protocols compatible with M. jannaschii's native deep-sea habitat

    • Optimize electroporation parameters for cells grown at high temperatures

    • Consider polyethylene glycol (PEG)-mediated transformation adapted for hyperthermophiles

    • Use liposome-mediated DNA delivery systems resistant to extreme conditions

  • Selection Markers:

    • Utilize thermostable antibiotic resistance genes functional at 85°C

    • Develop auxotrophic strains and complementary markers

    • Consider gas production/consumption as potential selection methods for methanogens

    • Implement CRISPR-Cas9 systems adapted for high-temperature function

  • Expression Systems:

    • Identify native M. jannaschii promoters from highly expressed genes

    • Develop inducible promoter systems functional at high temperatures

    • Create shuttle vectors capable of replication in both E. coli and M. jannaschii

    • Consider integration into chromosomal or extrachromosomal elements

Experimental Design Strategies:

  • Gene Deletion/Disruption:

    • Determine if MJ1566 is essential through conditional knockdown approaches

    • Use homologous recombination for targeted gene replacement

    • Implement CRISPR interference for gene silencing when complete deletion is not possible

    • Consider transposon mutagenesis for random disruption libraries

  • Protein Tagging:

    • Design thermostable epitope tags for protein detection

    • Create fluorescent protein fusions using thermostable variants

    • Implement proximity-labeling approaches adapted for high temperatures

    • Use split-protein complementation assays to detect in vivo interactions

  • Alternative Host Systems:

    • Consider genetic studies in related but more genetically tractable archaea (Thermococcus kodakarensis)

    • Create heterologous expression systems in mesophilic hosts with appropriate temperature-dependent controls

    • Implement complementation studies in model organisms with identified homologs

Controls and Validation:

Experiment TypeEssential ControlsValidation ApproachesSpecial Considerations
Gene deletionWild-type comparisonGenomic PCR, RT-PCRGrowth at multiple temperatures
Protein taggingUntagged controlWestern blot, mass spectrometryTag stability at high temperature
OverexpressionEmpty vector controlqRT-PCR, proteomicsCodon optimization
CRISPR interferenceNon-targeting sgRNARNA-seq, RT-PCRGuide RNA stability

Researchers should consider that genetic manipulation protocols established for model organisms require significant adaptation for extremophiles like M. jannaschii that grow optimally at 85°C and under high pressure conditions.

How can systems biology approaches illuminate MJ1566 function in the context of M. jannaschii's extreme environment adaptation?

Systems biology offers powerful approaches to understand MJ1566 within the broader context of M. jannaschii's adaptation to extreme environments:

Multi-omics Integration:

  • Transcriptomics:

    • Perform RNA-seq under varying conditions (temperature, pressure, nutrient limitation)

    • Identify co-expressed genes that correlate with MJ1566 expression patterns

    • Map transcriptional responses to environmental stressors

    • Develop condition-specific gene regulatory networks

  • Proteomics:

    • Quantify protein abundance changes across environmental gradients

    • Identify post-translational modifications specific to extreme conditions

    • Map protein-protein interaction networks under native conditions

    • Compare theoretical proteome based on genome annotation with actual expressed proteins

  • Metabolomics:

    • Profile metabolite changes in response to environmental shifts

    • Correlate metabolite levels with MJ1566 expression/activity

    • Identify metabolic bottlenecks in methanogenesis pathways

    • Compare metabolic profiles of wild-type and MJ1566 mutant strains

  • Comparative Genomics:

    • Analyze MJ1566 conservation across archaeal species from diverse environments

    • Identify genomic signatures of thermoadaptation in gene neighborhoods

    • Compare archaeal genomes to identify unique features of methanogenic archaea

    • Examine evolutionary rates of MJ1566 relative to housekeeping genes

Computational Modeling:

  • Metabolic Flux Analysis:

    • Develop genome-scale metabolic models of M. jannaschii

    • Perform flux balance analysis to predict metabolic states

    • Use 13C labeling experiments to validate predicted fluxes

    • Simulate gene knockouts to predict MJ1566 metabolic impacts

  • Network Analysis:

    • Construct protein-protein interaction networks

    • Identify functional modules and pathway enrichment

    • Perform topological analysis to find critical network nodes

    • Compare network architecture with mesophilic organisms

  • Molecular Dynamics Simulations:

    • Model protein behavior at high temperatures and pressures

    • Simulate conformational changes under varying conditions

    • Predict protein-solvent interactions at extreme conditions

    • Calculate energetic contributions to thermostability

Integration and Visualization:

Data TypeAnalysis MethodIntegration ApproachVisualization Tool
TranscriptomicDifferential expressionCorrelation with proteomeHeatmaps, PCA plots
ProteomicProtein abundance quantificationPathway mappingProtein interaction networks
MetabolomicMetabolite profilingFlux modelingPathway diagrams
GenomicComparative genomicsPhylogenetic profilingSynteny plots

This systems biology framework can reveal MJ1566's role in M. jannaschii's remarkable adaptation to deep-sea hydrothermal vents where it thrives at temperatures up to 94°C and pressures over 500 atmospheres . The integration of multiple data types provides robust hypotheses about protein function that can be experimentally validated through targeted approaches.

What experimental controls and validation studies are critical when working with an uncharacterized protein like MJ1566?

Rigorous experimental design for studying uncharacterized proteins like MJ1566 requires comprehensive controls and validation approaches:

Essential Experimental Controls:

  • Protein Characterization Controls:

    • Empty vector controls in expression studies

    • Non-His-tagged protein controls in affinity purification

    • Heat-denatured protein controls in activity assays

    • Protein-free buffer controls in binding studies

    • Non-specific protein controls (e.g., BSA) at equivalent concentrations

  • Functional Assay Controls:

    • Positive controls using well-characterized enzymes with similar predicted functions

    • Substrate-free and enzyme-free reactions

    • Time-zero measurements to establish baselines

    • Concentration gradients to establish dose-dependency

    • Technical and biological replicates to assess reproducibility

  • Specificity Controls:

    • Point mutants of predicted catalytic residues

    • Truncated protein variants lacking key domains

    • Homologous proteins from related organisms

    • Chemical inhibitors when available

    • Competitive binding assays with predicted ligands

Validation Approaches:

  • Orthogonal Method Validation:

    • Confirm activity using multiple independent assay techniques

    • Verify protein-protein interactions using complementary methods (e.g., pull-down, SPR, ITC)

    • Validate structural predictions with experimental structure determination

    • Cross-validate omics findings with targeted biochemical assays

  • In Vivo Validation:

    • Gene knockout/knockdown phenotype analysis

    • Complementation studies in appropriate model systems

    • Localization studies to confirm subcellular distribution

    • Expression correlation with related pathway components

    • Physiological relevance under native-like conditions

  • Cross-Species Validation:

    • Test conserved function in homologs from related archaea

    • Compare activity parameters across thermophilic and mesophilic variants

    • Establish evolutionary conservation of biochemical properties

    • Perform complementation studies in diverse hosts

Replication and Statistical Analysis:

Experiment TypeMinimum ReplicationStatistical ApproachPower Analysis
Enzyme kineticsTriplicate, ≥5 substrate concentrationsNon-linear regressionSample size for desired confidence
Binding assaysDuplicate, ≥7 concentrationsEquilibrium binding modelsParameter error estimation
Thermal stabilityTriplicate, multiple heating ratesThermal shift analysisTemperature resolution calculation
Growth studiesBiological triplicatesANOVA, growth curve analysisMinimum detectable difference

Reporting Standards:

  • Complete description of experimental conditions, particularly temperature, pH, buffer composition, and incubation times

  • Transparent reporting of all controls and validations, including negative results

  • Deposition of data in appropriate repositories (PDB, PRIDE, MetaboLights)

  • Detailed methods sections enabling reproduction by independent laboratories

  • Proper statistical analysis and clear indication of uncertainty in measurements

What are the most promising research directions for further characterization of MJ1566?

Based on our current understanding of M. jannaschii biology and the limited information about MJ1566, several high-priority research directions emerge:

  • Comprehensive Structural Characterization:

    • Determine the three-dimensional structure through X-ray crystallography or cryo-EM

    • Perform comparative structural analysis with proteins of known function

    • Identify potential active sites and binding pockets for functional hypotheses

    • Investigate structural adaptations that enable function at high temperatures

  • Systematic Functional Screening:

    • Develop high-throughput screening approaches for enzyme activity discovery

    • Test involvement in methanogenesis pathways given M. jannaschii's core metabolism

    • Examine potential roles in extreme environment adaptation mechanisms

    • Investigate possible involvement in archaeal-specific cellular processes

  • Genetic Context Exploration:

    • Analyze gene neighborhood and operon structure in the M. jannaschii genome

    • Create knockout/knockdown strains to assess phenotypic effects

    • Perform complementation studies in related archaeal species

    • Investigate regulatory mechanisms controlling MJ1566 expression

  • Comparative Biology Approaches:

    • Identify and characterize homologs across the archaeal domain

    • Perform evolutionary analysis to track functional conservation/divergence

    • Compare properties with homologs from mesophilic vs. thermophilic species

    • Investigate potential horizontal gene transfer events involving MJ1566

The systematic integration of these research directions will progressively illuminate the biological role of MJ1566 and potentially reveal novel biochemical functions adapted to extreme environments.

How does studying MJ1566 contribute to broader understanding of archaeal biology?

Investigating an uncharacterized protein like MJ1566 from M. jannaschii contributes significantly to broader archaeological biology understanding:

  • Expanding the Archaeological Functional Proteome:

    • Reduces the proportion of hypothetical proteins in archaeal genome annotations

    • Contributes to building a more complete functional map of archaeal cellular processes

    • Helps identify archaeal-specific biochemical pathways not present in bacteria or eukaryotes

    • Establishes functional connections between previously unrelated proteins

  • Understanding Extremophile Adaptations:

    • Reveals molecular mechanisms underlying thermostability in proteins

    • Identifies strategies for maintaining protein function under extreme conditions

    • Contributes to understanding how life can thrive in Earth's most extreme environments

    • Provides insights into potential adaptation mechanisms for early life forms

  • Evolutionary Insights:

    • Illuminates archaeal contributions to the tree of life

    • Helps resolve questions about the evolution of cellular processes across domains

    • Identifies ancient conserved protein functions that predate domain divergence

    • Contributes to understanding horizontal gene transfer in archaeal evolution

  • Biotechnological Applications:

    • Discovers enzymes with potential applications in high-temperature industrial processes

    • Identifies novel catalytic mechanisms optimized for extreme conditions

    • Provides templates for protein engineering to enhance thermostability

    • Reveals unique biochemical pathways with potential biotechnological applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.