KEGG: mja:MJ_1570
STRING: 243232.MJ_1570
MJ1570 is an uncharacterized protein derived from Methanocaldococcus jannaschii, a thermophilic methanogenic archaean belonging to the domain Archaea . M. jannaschii was the first archaeon to have its complete genome sequenced, which revealed numerous genes unique to archaea, including MJ1570 . This organism was isolated from submarine hydrothermal vents at depths of 2600m near the western coast of Mexico, where it thrives in extreme conditions including temperatures ranging from 48-94°C, high pressure, and moderate salinity .
Recombinant MJ1570 is a full-length protein consisting of 115 amino acids with the following sequence: MNWQDPLVKKFLYLIVAMVILCPLGILLVWNYGDAWGEWGPEDVAEKVGEDKVSGLLHLADIWSYAPLPDYDIPGWDDPFHASIGYIISAIVGVILCVGAYYALIKIVNPKAAAG . The commercially available recombinant protein is typically expressed in E. coli with an N-terminal His-tag to facilitate purification . The protein is supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .
While specific comparative data between MJ1570 and other uncharacterized proteins from M. jannaschii is limited in the available literature, we can note significant differences in structure and sequence compared to proteins like MJ1470. For instance, MJ1470 is substantially larger (624 amino acids vs. 115 for MJ1570) and has a different amino acid composition . This variance suggests these proteins likely serve different biological functions within M. jannaschii, despite both being classified as uncharacterized. Many proteins from M. jannaschii contain inteins (protein splicing elements), though it's unclear from the available data whether MJ1570 contains these elements .
For optimal stability and activity of recombinant MJ1570, observe these research-validated protocols:
| Storage Parameter | Recommendation | Notes |
|---|---|---|
| Long-term storage | Store at -20°C/-80°C | Aliquoting necessary for multiple use |
| Working aliquots | Store at 4°C | For up to one week |
| Storage buffer | Tris/PBS-based buffer with 6% Trehalose, pH 8.0 | Prevents protein degradation |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL | Add glycerol for long-term storage |
| Glycerol concentration | 5-50% (final concentration) | Default recommendation is 50% |
| Freeze-thaw cycles | Avoid repeated freezing and thawing | Compromises protein integrity |
Prior to opening, briefly centrifuge the vial to collect contents at the bottom . After reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, the addition of glycerol (final concentration of 5-50%) is recommended for long-term storage at -20°C/-80°C .
The predominant expression system for MJ1570 production is E. coli, which has been successfully employed to generate His-tagged recombinant protein with high purity (>90%) . For thermostable proteins from hyperthermophilic organisms like M. jannaschii, E. coli expression requires careful optimization of growth conditions, induction parameters, and purification protocols to preserve the native conformation while achieving high yields. The methodological approach typically involves:
Cloning the MJ1570 gene into an expression vector containing an N-terminal His-tag
Transforming the construct into an appropriate E. coli strain (e.g., BL21(DE3))
Optimizing culture conditions to minimize inclusion body formation
Inducing expression under controlled temperature and duration
Purifying using immobilized metal affinity chromatography (IMAC)
Performing quality control via SDS-PAGE and activity assays
This methodology balances protein yield with preservation of potential thermostable properties that might be relevant for downstream applications .
Characterizing uncharacterized proteins like MJ1570 requires a systematic, multi-faceted approach:
Bioinformatic analysis: Employ sequence alignment tools (BLAST, HMMER), structural prediction algorithms (AlphaFold, Rosetta), and phylogenetic analysis to identify potential homologs or functional domains.
Structural studies: Utilize X-ray crystallography, NMR spectroscopy, or cryo-EM to determine the three-dimensional structure, which may provide insights into function.
Biochemical assays: Design activity assays based on predicted functions from bioinformatic analysis, testing for enzymatic activity, nucleic acid binding, or protein-protein interactions.
Protein-protein interaction studies: Employ yeast two-hybrid, pull-down assays, or co-immunoprecipitation to identify potential binding partners within M. jannaschii proteome.
Genetic approaches: Generate knockout or knockdown mutants in model organisms (if feasible) to assess phenotypic changes and metabolic impact.
Transcriptomic analysis: Examine expression patterns under various growth conditions to infer functional relationships with known metabolic pathways.
This comprehensive approach has proven effective for functionally annotating previously uncharacterized archaeal proteins and could yield valuable insights into MJ1570's role in M. jannaschii biology .
Analysis of MJ1570's amino acid sequence (MNWQDPLVKKFLYLIVAMVILCPLGILLVWNYGDAWGEWGPEDVAEKVGEDKVSGLLHLADIWSYAPLPDYDIPGWDDPFHASIGYIISAIVGVILCVGAYYALIKIVNPKAAAG) reveals several hydrophobic regions consistent with transmembrane domains . The sequence contains segments rich in hydrophobic amino acids (like leucine, isoleucine, valine, and phenylalanine), interspersed with charged and polar residues. This pattern suggests MJ1570 may function as:
A membrane-integrated transport protein, potentially involved in ion or small molecule translocation
A component of membrane-associated metabolic complexes related to methanogenesis
A structural protein contributing to membrane integrity under extreme conditions
A sensor protein responding to environmental changes at the membrane interface
These potential functions align with M. jannaschii's requirements for maintaining cellular homeostasis in extreme environments, particularly its thermophilic and high-pressure deep-sea habitat .
The extremophilic nature of M. jannaschii, which thrives in hydrothermal vents under high temperature (48-94°C) and pressure conditions, suggests that its proteins, including MJ1570, may possess unique stability properties adaptable to biotechnological applications . Potential research applications include:
Thermal stability engineering: Studying MJ1570's structural elements could inform the design of thermostable proteins for industrial processes requiring high-temperature catalysis.
Membrane protein research platforms: As a potential membrane protein from an archaeal source, MJ1570 could serve as a model for studying membrane protein folding and stability under extreme conditions.
Biocatalysis in non-conventional media: If enzymatic activity is identified, MJ1570 might function in organic solvents or at extremes of pH where conventional enzymes fail.
Archaeal expression system development: Insights from studying MJ1570's expression could contribute to developing archaeal-based protein production systems for difficult-to-express proteins.
Renewable energy applications: If involved in methanogenesis pathways, MJ1570 might inform development of biofuel production processes similar to those being explored with Archaea Energy's renewable natural gas facilities .
Methodologically, these applications would require detailed structural characterization, followed by targeted mutagenesis to identify stability-conferring elements that could be transferred to proteins of industrial interest.
A comprehensive computational strategy for predicting MJ1570's interaction network would integrate multiple predictive methodologies:
Structural docking simulations: Utilizing the predicted three-dimensional structure of MJ1570 to perform in silico docking studies with known M. jannaschii proteins.
Co-evolution analysis: Examining patterns of coordinated amino acid changes across multiple species to identify potential interacting partners that have co-evolved with MJ1570.
Genomic context methods: Analyzing gene neighborhood, gene fusion events, and phylogenetic profiles to predict functional associations.
Machine learning approaches: Training algorithms on known protein-protein interaction datasets from archaeal species to predict novel interactions.
Network-based inference: Utilizing existing protein interaction networks from closely related species to infer potential interactions in M. jannaschii.
This integrated approach could generate testable hypotheses about MJ1570's functional partners within the M. jannaschii proteome, potentially revealing its role in archaeal-specific metabolic pathways or information processing systems .
Expressing archaeal membrane proteins in heterologous systems presents several specific challenges that researchers must address methodically:
Membrane composition differences: Archaeal membranes contain ether-linked lipids rather than ester-linked phospholipids found in bacteria and eukaryotes, potentially affecting proper folding and insertion of membrane proteins in heterologous systems.
Codon usage bias: Significant differences in codon preferences between archaea and expression hosts like E. coli may reduce translation efficiency.
Post-translational modifications: Archaeal-specific modifications may be absent in heterologous systems, potentially affecting protein function or stability.
Protein toxicity: Overexpression of membrane proteins often causes toxicity to host cells, limiting yield.
Inclusion body formation: High expression levels frequently lead to protein aggregation rather than proper membrane insertion.
Methodological solutions include:
Codon optimization for the expression host
Using specialized E. coli strains (C41/C43) designed for membrane protein expression
Employing fusion partners (MBP, SUMO) to enhance solubility
Optimizing induction conditions (lower temperature, reduced inducer concentration)
Co-expressing archaeal chaperones to assist proper folding
Using archaeal lipid extracts in purification buffers to stabilize the native conformation
These approaches have been successfully applied to other archaeal membrane proteins and could be adapted for MJ1570 expression .
Differentiating authentic biological functions from experimental artifacts requires rigorous experimental design and multiple lines of evidence:
Environmental relevance validation: Test protein activity under conditions mimicking the native environment of M. jannaschii (high temperature, pressure, and salt concentration).
Multiple expression systems comparison: Express MJ1570 in different hosts (E. coli, yeast, cell-free systems) and compare functional properties to identify system-specific artifacts.
Mutagenesis controls: Systematically mutate key residues predicted to be functionally important; loss of activity supports authentic function rather than artifact.
In vivo validation: When possible, conduct complementation studies or gene deletion/knockdown in related archaeal species that are genetically tractable.
Correlation with physiological conditions: Examine how activity correlates with conditions known to affect M. jannaschii physiology.
Structural integrity verification: Use circular dichroism or thermal shift assays to confirm proper folding under experimental conditions.
Native extraction comparison: Compare properties of heterologously expressed protein with protein extracted directly from M. jannaschii, if feasible.
This methodical approach helps establish confidence in functional assignments by distinguishing reproducible, biologically relevant activities from system-dependent artifacts .
A comprehensive comparative analysis of MJ1570 across archaeal species requires multi-level examination:
Sequence conservation patterns: Multiple sequence alignment reveals that while MJ1570 has limited sequence identity with proteins from other archaeal species, conservation is typically higher in the predicted transmembrane regions and potential functional domains.
Structural conservation: Despite sequence divergence, structural prediction suggests conservation of membrane-spanning regions and potential binding pockets across homologs.
Genomic context conservation: Analysis of neighboring genes across species can provide functional insights, as operonic organization is often preserved for functionally related genes.
Domain architecture: Examination of domain organization within homologs may reveal functional modules maintained throughout archaeal evolution.
Phylogenetic distribution: The presence/absence pattern of MJ1570 homologs correlates with specific metabolic capabilities or environmental adaptations across archaeal species.
This comparative approach places MJ1570 in an evolutionary context, potentially revealing its contribution to the unique adaptations of methanogenic archaea to extreme environments .
Genomic context analysis provides crucial insights into potential functional relationships:
Operonic organization: Determining whether MJ1570 is part of an operon with other genes suggests functional coordination in specific biological processes.
Regulon membership: Identifying shared regulatory elements between MJ1570 and other genes indicates co-regulation under specific environmental conditions.
Chromosomal clustering: Physical proximity to genes of known function on the M. jannaschii chromosome may suggest participation in shared pathways.
Synteny analysis: Comparing gene order conservation across related methanogenic archaea can reveal functional modules maintained through evolutionary pressure.
Transcriptional response correlation: Analyzing co-expression patterns under various conditions provides evidence for functional relationships.
This genomic context approach has proven valuable for functional annotation of uncharacterized genes in model organisms and could provide significant insights into MJ1570's biological role within the unique metabolism of M. jannaschii .