Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1577 (MJ1577)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MJ1577 is a 598-amino acid protein (UniProt ID: Q58972) derived from Methanocaldococcus jannaschii, a thermophilic archaeon isolated from deep-sea hydrothermal vents . The recombinant variant is expressed in E. coli with an N-terminal His tag, enabling purification via affinity chromatography .

Genomic and Functional Context

  • Genomic Significance: MJ1577 is part of the first archaeal genome sequenced (1996), which revealed unique metabolic and information-processing pathways distinct from bacteria and eukaryotes .

  • Functional Characterization: Classified as "uncharacterized," MJ1577 lacks confirmed enzymatic or pathway associations. Computational analyses suggest potential roles in stress response or novel metabolic processes, but experimental validation is pending .

  • Conservation: Homologs of MJ1577 are absent in well-studied model organisms, underscoring its archaeal specificity .

Research Implications

  • Hypothesized Roles: MJ1577 may contribute to extremophile adaptation mechanisms, such as thermostability or methanogenesis regulation, given M. jannaschii’s reliance on hydrogenotrophic methane production .

  • Knowledge Gaps:

    • No confirmed interactions with other proteins or cofactors .

    • Pathway involvement remains undefined .

Future Directions

  • Structural Studies: X-ray crystallography or cryo-EM to resolve 3D architecture.

  • Functional Screens: Assays for enzymatic activity, ligand binding, or genetic knockout phenotypes.

  • Comparative Genomics: Analysis across methanogens to identify conserved motifs.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its use in the production process.
Synonyms
MJ1577; Uncharacterized protein MJ1577
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1577
Target Protein Sequence
MREEKEIIIVCLLIFIVGVVGIFLTTSFNGMKYTSIYIKDYEANLYIGKNLTLEEIYSYE VLEGRKYRMLYRDWKAPLVYNGSLNTPYVKVLNLSTSSKDMVGYVVDYKGDIFVFSDEDW IKRNIEEIVDKYYIRNEVGFYNPLYIRNPGIYTTSYKFVIYPPIETDNVFYHINLKLADE HLPYKNVKINVIDENNSILDLFVYPSTFKVYKTYFGYTIEGSSPKNDPIEVEMLLKPNSV NGFTRYVYNVEGKTISAYKKYTFVSNIVMTLKYLLMAIILLFPLIAYIIYLKFGKEKFYV VPEYLSYVPNKNRKPWIVNLIFAGDAGFFDKEGFYATLLDLHNRGYIKIMNGGKIEILKT DLENLDVYESDVMKFLMKYSKNNVFDPEYIKSLAQKYKSSKDKLKKLKDELDKIMEYPRY SSKVVNAFLETRGKKIIIALLVISILLAVFLYFIPKYSQTFNEVFYLSIVFVVQNIILAL TPTSLFGRWKANYYKEKLEWDAFKNFLSNLAMIKKYSPEDISIWKDWLIYGTALGVGDKV VEAMKSLNLSELVADYVIIHSNYDSMKTSVDSVYSSTTGSGGGFGAGGGFGGGGGGAR
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1577

STRING: 243232.MJ_1577

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and where is the MJ1577 gene located in its genome?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon with a complete genome sequence of 1.66 megabase pairs. The genome consists of three distinct elements: a large circular chromosome of 1,664,976 base pairs, a large extrachromosomal element of 58,407 bp, and a small extrachromosomal element of 16,550 bp . The MJ1577 gene is located on the main chromosome and represents one of the 1,682 predicted protein-coding regions identified in the genome sequencing project. The gene annotation follows the systematic naming convention where "MJ" designates Methanocaldococcus jannaschii, and "1577" indicates its position in the sequential numbering of open reading frames (ORFs) in the annotated genome.

Why is MJ1577 classified as an "uncharacterized protein"?

MJ1577 is classified as "uncharacterized" because it belongs to the category of ORFs in the M. jannaschii genome that did not elicit significant homology matches with known sequences from either M. jannaschii itself or other organisms during initial genome annotation . This classification indicates that at the time of genome sequencing and annotation, the protein's function could not be confidently predicted based on sequence similarity to proteins of known function. Many such uncharacterized proteins in archaea represent opportunities for novel discoveries, as they may possess unique structural features or biochemical activities adapted to extreme environments.

What expression systems are suitable for recombinant production of MJ1577?

Several expression systems can be considered for the recombinant production of MJ1577, with homologous and heterologous options available. For homologous expression, the recently developed genetic system for M. jannaschii represents a significant advancement . This system has successfully been used to overexpress the FprA protein with affinity tags, suggesting it could be adapted for MJ1577 expression. The approach involves constructing a suicide plasmid containing DNA elements representing upstream and 5'-end coding regions of the target gene, allowing double cross-over homologous recombination with the chromosome .

For heterologous expression, E. coli systems optimized for archaeal proteins are commonly used, though they often require codon optimization and consideration of the protein's thermostability. Expression yields in M. jannaschii's homologous system (e.g., 0.26 mg purified protein per liter culture for FprA) should be compared with heterologous systems when determining the most efficient production method .

What are the predicted structural features of the MJ1577 protein?

While specific structural data for MJ1577 may not be widely available, prediction of its structural features can be approached through computational methods. Sequences of uncharacterized M. jannaschii proteins can be analyzed for secondary structure elements, domain organization, and potential functional motifs using tools like Pfam, InterPro, and I-TASSER. Archaeal proteins, particularly those from hyperthermophiles like M. jannaschii, often exhibit unique structural adaptations that confer thermostability, including increased hydrophobic core packing, additional salt bridges, and reduced surface loop regions.

Researchers should note that for proteins with low sequence similarity to characterized proteins (<30% identity), structural predictions may have limited accuracy. Experimental validation through techniques such as circular dichroism, X-ray crystallography, or cryo-electron microscopy would be necessary for definitive structural characterization.

What experimental design would optimize the functional characterization of MJ1577?

A comprehensive experimental design for functionally characterizing MJ1577 would benefit from a multi-stage approach similar to the one outlined for complex experimental scenarios . A recommended design includes:

Stage 1: Initial Characterization

  • Expression and purification optimization using various affinity tags (similar to the 3xFLAG-twin Strep tag system used for FprA)

  • Basic biochemical characterization (molecular weight, oligomeric state, thermostability)

  • Preliminary activity screens across diverse substrates and cofactors

Stage 2: Detailed Functional Analysis

  • Investigation of promising activities identified in Stage 1

  • Application of central composite designs to optimize reaction conditions

  • Exploration of structure-function relationships through limited proteolysis and domain analysis

Stage 3: Validation and Contextual Understanding

  • In vivo functional validation using the M. jannaschii genetic system

  • Comparative analysis with homologous proteins (if identified)

  • Integration with metabolic pathways through protein-protein interaction studies

The design should include center point replicates for quality control and assessment of experimental variability, with data analysis performed after each stage to guide subsequent experiments .

How can the M. jannaschii genetic system be optimized for studying MJ1577 function in vivo?

The genetic system developed for M. jannaschii offers promising opportunities for studying MJ1577 in vivo . Optimization strategies include:

  • Selection Marker Refinement: While the current system uses mevinolin/simvastatin resistance via the Psla-hmgA cassette, alternative selection systems could be developed for MJ1577 studies to allow multiple genetic manipulations .

  • Promoter Engineering: Controlling MJ1577 expression levels through modified versions of native promoters (such as the engineered PflaB1B2 used for FprA) would enable conditional expression studies .

  • Affinity Tag Optimization: The 3xFLAG-twin Strep tag system successfully used for FprA protein purification yielded 0.26 mg/L, but alternative tag configurations or positions might improve yields for MJ1577 .

  • Knockout/Knockdown Strategies: Developing CRISPR-Cas or antisense RNA approaches adapted to extreme thermophilic conditions would enable loss-of-function studies to determine essentiality and phenotypic effects.

  • Complementation Systems: Creating a platform for expressing MJ1577 variants in a ΔMJ1577 background would facilitate structure-function analyses through mutational studies.

Implementation would require careful consideration of M. jannaschii's growth requirements (anaerobic, high temperature, high pressure) and the thermostability of genetic tools.

What approaches can resolve contradictory functional predictions for MJ1577?

When functional predictions for uncharacterized proteins like MJ1577 yield contradictory results, a systematic resolution approach should include:

  • Multi-algorithm consensus analysis: Compare predictions from diverse tools that use different algorithms (homology-based, structure-based, and context-based approaches).

  • Phylogenetic profiling: Analyze the co-occurrence patterns of MJ1577 with proteins of known function across diverse archaea to identify potential functional associations.

  • Structural homology beyond sequence similarity: Employ fold recognition tools to identify potential structural similarities that may not be evident from sequence analysis alone, noting that proteins with <30% sequence identity can share similar functions if they maintain conserved structural features .

  • Experimental validation hierarchy:

ApproachAdvantagesLimitationsPriority
Domain-based assaysTarget specific predicted functionsMay miss novel activitiesHigh
Untargeted metabolomicsCan reveal unexpected substratesRequires sophisticated instrumentationMedium
Protein-protein interaction studiesPlaces protein in biological contextMay not directly reveal functionMedium
Gene knockout phenotypingProvides in vivo relevanceChallenging in archaea; may have no phenotypeHigh if genetic system available
  • Integration with contextual genomic data: Analyze operon structure and gene neighborhood in M. jannaschii and related species to identify functional relationships.

The final functional assignment should be made only after experimental evidence confirms computational predictions, with clear documentation of confidence levels for each functional aspect.

What purification protocol would yield the highest activity of recombinant MJ1577?

Developing an optimal purification protocol for MJ1577 should consider the thermophilic nature of M. jannaschii proteins and build upon successful approaches used for other proteins from this organism. Based on the purification of affinity-tagged FprA protein , a recommended protocol would include:

  • Expression System Selection:

    • Homologous expression in M. jannaschii using the developed genetic system with PflaB1B2 promoter and affinity tags

    • Cultivation under strict anaerobic conditions at 70-85°C

  • Cell Lysis Considerations:

    • Perform under anaerobic conditions to preserve potential oxygen-sensitive activities

    • Use detergent combinations optimized for archaeal membrane proteins if MJ1577 shows membrane association

  • Purification Strategy:

    • Initial capture using Streptactin XT superflow column for twin Strep-tagged constructs, with elution using 10 mM D-biotin

    • Secondary purification through size exclusion chromatography under anaerobic conditions

    • Consider heat treatment (80-85°C) as a purification step to eliminate E. coli proteins when using heterologous expression

  • Quality Control Assessment:

    • SDS-PAGE analysis to confirm homogeneity

    • Western blot analysis using anti-FLAG or anti-Strep antibodies to confirm tag presence

    • Mass spectrometric analysis of thermolysin digests to verify protein identity and coverage

  • Activity Preservation:

    • Include stabilizing cofactors identified during initial activity screens

    • Store under anaerobic conditions with reducing agents to maintain redox-sensitive sites

    • Test stability at various temperatures to determine optimal storage conditions

This protocol should yield protein preparations with specific activities comparable to or exceeding those reported for other M. jannaschii proteins, such as the FprA oxygen reduction activity of 2,100 μmole/min/mg at 70°C .

How can researchers determine if MJ1577 contains post-translational modifications or unusual amino acids?

Detecting post-translational modifications (PTMs) or unusual amino acids in archaeal proteins like MJ1577 requires specialized analytical approaches:

  • Mass Spectrometry-Based Approaches:

    • High-resolution LC-MS/MS analysis with multiple fragmentation methods (CID, ETD, HCD) to maximize coverage and PTM identification

    • Top-down proteomics of the intact protein to determine the total mass shift from the predicted sequence

    • Targeted analysis for archaeal-specific modifications such as methylation, acetylation, and unusual thioamidation found in extremophiles

  • Specialized PTM Enrichment:

    • Phosphoprotein-specific staining or titanium dioxide enrichment for phosphorylation

    • Lectin affinity chromatography for potential glycosylation

    • Metal-affinity chromatography for metal-binding sites

  • Analysis for Unusual Amino Acids:

    • Amino acid analysis after complete acid hydrolysis

    • Comparison of experimental masses with those predicted from genomic sequence

  • Structural Evidence:

    • Electron density anomalies in X-ray crystallography data suggesting modifications

    • NMR spectroscopy for identifying non-standard chemical shifts

When analyzing MS data for MJ1577, researchers should consider the sequence coverage achieved, which ideally should exceed 55% (the coverage reported for FprA analysis) , and implement appropriate controls to distinguish genuine PTMs from artifacts of sample preparation.

What computational approaches can predict potential interaction partners of MJ1577?

Predicting potential interaction partners for an uncharacterized protein like MJ1577 requires integrative computational approaches:

  • Genomic Context Methods:

    • Gene neighborhood analysis across archaeal genomes

    • Gene fusion detection to identify domains that appear fused in other organisms

    • Phylogenetic profiling to identify genes with correlated presence/absence patterns across species

  • Structure-Based Predictions:

    • Protein-protein docking simulations using homology models

    • Interface prediction through conservation mapping and hydrophobicity analysis

    • Electrostatic complementarity assessment, particularly important in thermophilic organisms where electrostatic interactions contribute significantly to protein stability

  • Network-Based Approaches:

    • Literature-based relationship extraction from publications on M. jannaschii

    • Transfer of interaction data from better-characterized homologs in related archaeal species

    • Functional association networks based on combined genomic context methods

  • Experimental Validation Design:

    • Co-immunoprecipitation strategies using the established affinity tag system

    • Bacterial two-hybrid systems adapted for thermophilic proteins

    • Cross-linking mass spectrometry approaches optimized for archaeal samples

These computational predictions should be ranked according to confidence scores and prioritized for experimental validation, with special consideration given to proteins involved in pathways unique to methanogenic archaea.

How does temperature affect the structural stability and activity of recombinant MJ1577?

As a protein from the hyperthermophilic M. jannaschii, which grows optimally at 85°C, MJ1577 likely exhibits unusual temperature-dependent properties that should be systematically characterized:

  • Thermal Stability Assessment:

    • Differential scanning calorimetry (DSC) to determine melting temperatures (Tm)

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes across temperature ranges

    • Intrinsic fluorescence monitoring for tertiary structure stability

    • Activity measurements after exposure to various temperatures and durations

  • Temperature-Activity Relationship:

    • Determination of temperature optima for catalytic activity

    • Arrhenius plot analysis to calculate activation energies

    • Assessment of substrate specificity changes at different temperatures

  • Expected Characteristics Based on Other M. jannaschii Proteins:

    • High temperature optima (likely 70-90°C) for enzymatic activity

    • Potential activity retention at mesophilic temperatures, similar to the measurable 2,100 μmole/min/mg activity of M. jannaschii FprA at 70°C

    • Unusually high structural stability against thermal denaturation

  • Structural Basis of Thermostability:

    • Identification of stabilizing salt bridges through mutagenesis

    • Analysis of hydrophobic core packing using structural models

    • Comparison with mesophilic homologs if identified

This characterization would provide valuable insights not only for optimizing experimental conditions but also for understanding the molecular adaptations enabling protein function in extreme environments.

How can researchers design experiments to identify the physiological substrate of MJ1577?

Identifying the physiological substrate of an uncharacterized protein like MJ1577 requires a systematic experimental design approach:

  • Initial Substrate Screening:

    • Metabolite profiling of M. jannaschii extracts under different growth conditions

    • Thermal shift assays with metabolite libraries to identify potential ligands

    • Activity-based protein profiling with substrate analogs containing reactive groups

  • Experimental Design Optimization:

    • Implementation of a fractional factorial design to efficiently screen multiple potential substrates

    • Inclusion of center point replicates to assess experimental variability

    • Staged experimental approach with data analysis between stages to refine subsequent experiments

  • Validation Strategy:

    • Development of targeted assays for confirmed substrate candidates

    • Kinetic characterization across temperature ranges

    • Structural confirmation of substrate binding through crystallography or NMR

  • Physiological Context Assessment:

    • Metabolic flux analysis in M. jannaschii with and without MJ1577 manipulation

    • Correlation of MJ1577 expression levels with substrate availability

    • Growth phenotype analysis under varying substrate concentrations

This methodical approach would significantly increase the probability of identifying the true physiological substrate while minimizing resource expenditure on false leads.

What comparative genomics approaches can help understand the evolutionary significance of MJ1577?

Understanding the evolutionary context of MJ1577 through comparative genomics can provide insights into its function and importance:

  • Ortholog Identification and Analysis:

    • Systematic BLAST searches against archaeal and bacterial genomes

    • Implementation of reciprocal best hit methodology to identify true orthologs

    • Consideration of proteins with <30% sequence identity but similar structural predictions

  • Evolutionary Rate Analysis:

    • Calculation of dN/dS ratios to identify selective pressure

    • Assessment of site-specific conservation patterns

    • Identification of potentially functionally important residues based on evolutionary conservation

  • Domain Architecture Analysis:

    • Identification of domain fusion events across species

    • Tracking of domain gain/loss patterns in archaeal lineages

    • Analysis of domain architecture evolution relative to changes in organism habitat or metabolism

  • Phylogenetic Profiling Matrix:

Taxonomic GroupMJ1577 PresenceEnvironmental NicheMetabolic CharacteristicsCorrelation Significance
MethanococcalesHigh (>90%)Hydrothermal ventsMethanogenesisPrimary association
Other EuryarchaeotaVariableDiverseVarious anaerobicSecondary association
CrenarchaeotaLow (<10%)Mostly thermophilicVaried metabolismNegative association
BacteriaRare--Potential horizontal transfer
  • Genome Context Conservation:

    • Analysis of gene neighborhood conservation across species

    • Identification of conserved operonic structures

    • Assessment of potential functional relationships based on genomic proximity

This comparative genomics framework would provide essential context for understanding MJ1577's role in archaeal biology and potentially identify model organisms where homologs could be more easily studied.

What analytical techniques are most appropriate for detecting potential enzymatic activities of MJ1577?

Selection of appropriate analytical techniques for detecting enzymatic activities of an uncharacterized protein like MJ1577 should consider both the extreme conditions under which M. jannaschii proteins function and the need for sensitive, high-throughput methods:

  • High-Temperature Activity Assays:

    • Spectrophotometric assays adapted for high temperatures (70-85°C)

    • Coupled enzyme systems using thermostable coupling enzymes

    • Direct monitoring of substrate disappearance or product formation using HPLC or LC-MS

  • Redox Activity Assessment:

    • Evaluation as potential oxidoreductase using various electron donors/acceptors

    • Consideration of archaeal-specific cofactors like F420, similar to analysis of FprA which showed F420H2-dependent oxygen reduction activity of 2,100 μmole/min/mg at 70°C

    • Specialized anaerobic assay conditions to maintain redox-sensitive activities

  • Substrate Profiling Approaches:

    • Activity-based protein profiling with reactive probes

    • Substrate depletion assays monitored by LC-MS

    • Metabolite profiling of reaction mixtures to identify transformed compounds

  • Structural Changes Upon Substrate Binding:

    • Thermal shift assays (Thermofluor) adapted for high temperatures

    • Hydrogen-deuterium exchange mass spectrometry

    • Tryptophan fluorescence quenching for detecting conformational changes

The multi-stage experimental design approach recommended for complex experiments would be particularly valuable here, allowing researchers to efficiently narrow down potential activities before investing in more detailed characterization.

How can researchers optimize crystallization conditions for structural determination of MJ1577?

Crystallizing proteins from hyperthermophilic archaea like M. jannaschii presents unique challenges and opportunities. An optimized approach for MJ1577 would include:

  • Pre-crystallization Considerations:

    • Protein purity assessment (>95% by SDS-PAGE)

    • Dynamic light scattering to verify monodispersity

    • Limited proteolysis to identify stable domains if full-length protein proves recalcitrant

    • Consideration of affinity tag removal versus crystallization with tags intact

  • Crystallization Screening Strategy:

    • Implementation of sparse matrix screens at multiple temperatures (4°C, 20°C, and 37°C)

    • Exploration of higher temperature crystallization (45-60°C) using specialized equipment

    • Factorial design approach to systematically optimize promising conditions

    • Inclusion of potential substrates, cofactors, or inhibitors to stabilize protein conformation

  • M. jannaschii-Specific Considerations:

    • Addition of reducing agents to maintain potential redox-active sites

    • Exploration of high-salt conditions reflecting the organism's halophilic adaptations

    • Consideration of detergents for potentially membrane-associated regions

  • Optimization Matrix for Promising Conditions:

ParameterRange to TestIncrementRationale
pH5.0-9.00.5 unitsCover physiological range of M. jannaschii
Temperature4-60°C10-15°C intervalsAccount for thermostability
Precipitant concentration±30% of initial hit5% incrementsFine-tune crystal formation
Protein concentration5-15 mg/mL2.5 mg/mL incrementsOptimize nucleation vs. growth
AdditivesCommon ions, osmolytesStandard kitsStabilize crystal contacts
  • Advanced Approaches for Challenging Cases:

    • Surface entropy reduction mutations to promote crystal contacts

    • Crystallization with antibody fragments or designed binding proteins

    • In situ proteolysis during crystallization setup

This systematic approach to crystallization optimization would maximize chances of obtaining diffraction-quality crystals while accounting for the unique properties of archaeal proteins.

What integrated research strategies would most efficiently characterize MJ1577's role in M. jannaschii biology?

An integrated research strategy for comprehensively characterizing MJ1577 would combine multiple approaches in a coordinated workflow:

  • Sequential Experimental Program:

    • Initial bioinformatic analysis to generate function hypotheses

    • Recombinant expression and purification optimization

    • Preliminary biochemical characterization and activity screening

    • Structural characterization (crystallography, cryo-EM, or NMR)

    • Detailed mechanistic studies

    • In vivo validation using the M. jannaschii genetic system

  • Multi-disciplinary Technical Approach:

    • Genetic techniques: Gene knockout/knockdown, complementation studies

    • Biochemical methods: Activity assays, interaction studies

    • Structural biology: 3D structure determination, dynamics studies

    • Systems biology: Integration with metabolic networks

    • Evolutionary analysis: Comparative genomics, phylogenetics

  • Experimental Design Optimization:

    • Implementation of fractional factorial designs to efficiently explore multiple variables

    • Central composite designs for optimizing conditions around promising activities

    • Statistical analysis between experimental stages to guide subsequent approaches

  • Timeline and Resource Allocation:

    • Initial bioinformatic analysis and expression optimization (3-6 months)

    • Biochemical characterization and preliminary activity screening (6-12 months)

    • Structural studies (9-18 months, concurrent with biochemical work)

    • In vivo studies using genetic system (12-24 months)

    • Integration and final characterization (6-12 months)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.