Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1588 (MJ1588)

Shipped with Ice Packs
In Stock

Description

Introduction to Methanocaldococcus jannaschii and MJ1588

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon that has profound significance in the field of evolutionary biology and extremophile research. First isolated from a deep-sea hydrothermal vent, this organism thrives in extreme conditions that mirror early Earth environments, growing at temperatures between 48-94°C with an optimal temperature near 85°C, and at pressures up to more than 500 atmospheres . As the first hyperthermophilic chemolithotrophic organism isolated from a deep-sea hydrothermal vent, M. jannaschii derives energy solely through hydrogenotrophic methanogenesis, a metabolic pathway considered one of the most ancient respiratory mechanisms on Earth, dating back approximately 3.49 billion years .

The complete genome of M. jannaschii, comprising a 1.66-megabase pair chromosome and two extrachromosomal elements (58 kb and 16 kb), was sequenced in the late 1990s, revealing 1,738 predicted protein-coding genes . Among these genes, a significant proportion encode proteins with unknown functions, classified as "uncharacterized proteins." MJ1588 is one such protein, designated as uncharacterized due to insufficient experimental evidence regarding its biological role, despite its conservation within the archaeal domain.

The study of uncharacterized proteins like MJ1588 represents a crucial frontier in archaeal biology, as these proteins may hold keys to understanding unique adaptations to extreme environments, novel biochemical pathways, and evolutionary relationships between the three domains of life. Recent advances in genetic systems for M. jannaschii have opened new possibilities for functional characterization of these previously enigmatic proteins .

Sequence Analysis and Comparative Genomics

Sequence alignment and comparative genomics approaches offer valuable insights into potential functions of uncharacterized proteins. While the search results do not provide explicit information about homologs of MJ1588, similar approaches have been used with other uncharacterized proteins from M. jannaschii, such as MJ0188 . Such analyses typically involve identifying orthologous proteins across species and inferring function based on evolutionary conservation patterns.

The UniProt database entry for MJ1588 (accession number Q58983) provides a standardized reference point for this protein . This database entry would typically include annotations regarding predicted domains, post-translational modifications, and cross-references to other databases, though specific details aren't provided in the search results.

Recombinant Production and Purification Methods

The recombinant production of MJ1588 represents a significant achievement in the study of this uncharacterized protein. According to available information, the full-length protein (amino acids 1-112) has been successfully expressed in Escherichia coli with an N-terminal histidine tag . This expression system provides several advantages, including high yield, relatively simple purification, and compatibility with various downstream applications.

Expression Systems and Conditions

The histidine tag fusion strategy employed for MJ1588 is consistent with standard approaches for recombinant protein production. Histidine tags facilitate purification through immobilized metal affinity chromatography (IMAC) and generally have minimal impact on protein structure or function, making them ideal for initial characterization studies .

Purification and Quality Control

Following expression, the recombinant MJ1588 protein undergoes purification procedures to achieve greater than 90% purity as determined by SDS-PAGE . This level of purity is suitable for many biochemical and structural studies. The purified protein is typically provided as a lyophilized powder, which enhances stability during storage and transportation .

Storage recommendations for purified MJ1588 include keeping the protein at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios. Repeated freeze-thaw cycles should be avoided to maintain protein integrity. For working solutions, the protein can be stored at 4°C for up to one week .

The reconstitution protocol involves centrifuging the vial briefly before opening to bring contents to the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (5-50% final concentration) is recommended for long-term storage at -20°C/-80°C, with 50% being the default concentration . These handling specifications ensure maintenance of protein structure and activity for experimental applications.

Bioinformatic Approaches to Function Prediction

Bioinformatic analyses, including sequence similarity searches, domain identification, and structural prediction, represent valuable starting points for function prediction. Similar approaches have been applied to other uncharacterized proteins from M. jannaschii, such as MJ0188, which has been found to contain CBS domains and shares orthology with proteins from other archaeal species .

The development of integrative proteogenomics pipelines, such as JUMPg, has significantly enhanced the ability to identify and characterize previously unannotated proteins . These approaches integrate mass spectrometry data with RNA-seq data, enabling the identification of novel peptides resulting from amino acid substitutions, alternative splicing, frame shifts, and translations from supposedly "non-coding" regions. While the search results do not explicitly link MJ1588 to such analyses, similar methodologies could be applied to further characterize this protein.

Genetic Systems for Functional Characterization

Recent advances in genetic tools for M. jannaschii have transformed the capacity to investigate the functions of uncharacterized proteins in vivo. These tools enable gene knockout, gene modification, and the genetic fusion of affinity tags, facilitating the isolation of proteins with M. jannaschii-specific attributes . The application of these genetic systems to MJ1588 could provide critical insights into its physiological role, interactions with other cellular components, and contribution to the organism's survival in extreme environments.

For instance, knockout studies could reveal phenotypic changes associated with the absence of MJ1588, while affinity-tagged versions of the protein could be used for pull-down assays to identify interaction partners. These approaches have successfully been applied to validate the role of a novel coenzyme F420-dependent sulfite reductase in conferring resistance to sulfite in M. jannaschii , demonstrating their potential for functional characterization of MJ1588.

Context Within M. jannaschii Proteome and Genome

Understanding the genomic context and evolutionary history of MJ1588 provides additional perspectives on its potential functions and significance. M. jannaschii has a relatively compact genome of 1.66 megabase pairs, with predicted protein-coding genes that reflect adaptations to its extreme lifestyle .

Genomic Organization and Expression Patterns

The genomic location of MJ1588 and its relationship to nearby genes may offer clues about its function. In bacterial and archaeal genomes, functionally related genes are often organized in operons or gene clusters. Analysis of the genomic neighborhood of MJ1588 could reveal co-regulated genes involved in related biological processes.

M. jannaschii contains interesting genomic features, including multicopy repetitive elements with long repeat (LR) segments followed by variable numbers of short repeat (SR) segments . While the search results do not explicitly connect MJ1588 to these structural elements, understanding the broader genomic architecture provides context for interpreting the evolution and regulation of uncharacterized proteins.

Evolutionary Conservation and Ortholog Relationships

The InParanoid database approach, which has been applied to other M. jannaschii proteins like MJ0188, identifies ortholog groups across different species and provides bitscores to quantify similarity . Application of similar methods to MJ1588 would help place this protein in an evolutionary context and potentially connect it to functional pathways conserved across archaeal lineages.

Applications in Biotechnology and Research

Recombinant proteins from extremophiles like M. jannaschii often possess unique properties that make them valuable for biotechnological applications. The thermostability, pressure resistance, and other adaptations that enable function in extreme environments can be harnessed for industrial processes, enzyme development, and research tools.

Potential Biotechnological Applications

While the specific functions of MJ1588 remain unknown, proteins from hyperthermophiles generally exhibit exceptional stability that can be advantageous in industrial settings. Enzymes derived from thermophiles often function effectively under conditions that would denature their mesophilic counterparts, making them valuable catalysts for high-temperature processes.

Additionally, the unique molecular adaptations found in proteins from organisms like M. jannaschii can inspire the design of stabilized proteins for various applications. Even without knowing the precise function of MJ1588, its structural features might inform protein engineering efforts aimed at enhancing thermostability or pressure resistance in industrial enzymes.

Research Tool Applications

Recombinant MJ1588 serves as a valuable research tool for studying archaeal biology and extremophile adaptations. As a purified protein, it can be used in biochemical assays, structural studies, and interaction analyses to uncover its native function and contribute to our understanding of archaeal cellular processes.

The availability of the recombinant protein with a histidine tag facilitates various experimental approaches, including:

  • Protein-protein interaction studies through pull-down assays

  • Structural analysis via X-ray crystallography or NMR spectroscopy

  • Functional screens to identify substrates or activities

  • Generation of antibodies for localization studies

These research applications extend beyond the specific function of MJ1588 to broader questions about protein stability, archaeal biology, and the evolution of life in extreme environments.

Future Research Directions

The study of MJ1588 represents an ongoing scientific challenge with multiple promising avenues for future investigation. Several approaches could significantly advance our understanding of this uncharacterized protein and its role in M. jannaschii biology.

Integrative Omics Approaches

The application of integrative proteogenomics tools like JUMPg, which combine mass spectrometry data with RNA-seq analysis, could provide insights into the expression, post-translational modifications, and interactions of MJ1588 . Such approaches have successfully identified hundreds of previously unannotated peptides in complex biological samples, suggesting they could yield valuable information about MJ1588 in its native context.

Application of Genetic Systems

The recently developed genetic tools for M. jannaschii offer unprecedented opportunities to manipulate the MJ1588 gene and observe the resulting phenotypes . Gene knockouts, modifications, and fusions with reporter or affinity tags could reveal the protein's localization, interaction partners, and contribution to cellular processes. These genetic approaches would complement in vitro studies of the recombinant protein, providing physiological context for biochemical findings.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
MJ1588; Uncharacterized protein MJ1588
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1588
Target Protein Sequence
MVGNAYTLFEGNSADDLYKAIVKKRTTYEGKPTPLYQAILWSYKVVYTSEKKLIKSLIFR IGDNTIDSIKLYKKILGVFGGFIYILTPLPIVSGFLGNYYLKKKAKEKMKEV
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1588

STRING: 243232.MJ_1588

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the evolutionary significance of studying uncharacterized proteins like MJ1588 from M. jannaschii?

M. jannaschii represents one of the most ancient respiratory metabolisms on Earth, having evolved approximately 3.49 billion years ago. When its genome was first sequenced in 1996, approximately 60% of its genes could not be assigned predicted functions . Studying uncharacterized proteins like MJ1588 provides unique insights into primordial biochemical pathways that operated in early Earth conditions.

To approach this research, begin with comparative genomics analysis across archaeal species to identify conserved domains. Then apply phylogenetic profiling to establish evolutionary relationships with proteins of known function. This approach may reveal MJ1588's role in fundamental archaeal processes that have been conserved through billions of years of evolution.

How does M. jannaschii's hyperthermophilic nature affect the structural and functional properties of proteins like MJ1588?

M. jannaschii thrives at extremely high temperatures with an optimal growth temperature of 85°C and a remarkably fast doubling time of just 26 minutes . Proteins from this organism, including MJ1588, have evolved specific adaptations to maintain stability and function under these extreme conditions.

These adaptations typically include: (1) increased number of salt bridges, (2) higher proportion of charged amino acids on protein surfaces, (3) more compact hydrophobic cores, and (4) reduced flexibility in loop regions. When studying MJ1588, researchers should evaluate these structural features using comparative modeling with other hyperthermophilic proteins. Additionally, thermal stability assays should be conducted at temperatures ranging from 70-90°C to determine the protein's optimal functional temperature range.

What bioinformatic approaches are most effective for predicting potential functions of MJ1588?

For uncharacterized archaeal proteins like MJ1588, a multi-faceted bioinformatic approach yields the most reliable predictions:

  • Domain architecture analysis to identify conserved structural elements

  • Homology modeling against structurally characterized proteins

  • Genomic context analysis to identify operons or functional clusters

  • Motif scanning for catalytic sites or binding domains

When MJ0438 (Trm14) from M. jannaschii was characterized, researchers identified a canonical RNA recognition THUMP domain and a γ-class Rossmann fold that provided critical clues to its function as an RNA methylase . Similar structural analysis of MJ1588 could reveal functional domains that suggest enzymatic activity or binding partners.

What expression systems are most effective for recombinant production of M. jannaschii proteins like MJ1588?

While several expression systems can be used, E. coli remains the most efficient heterologous host for M. jannaschii proteins. Based on successful expression of other M. jannaschii proteins:

  • Clone the MJ1588 gene into a vector with a strong inducible promoter (e.g., pET22b+ as used for MJ0438)

  • Include a C-terminal His-tag for efficient purification

  • Transform into E. coli strains optimized for archaeal protein expression (BL21-CodonPlus(DE3)-RIL addresses codon bias)

  • Induce expression at lowered temperatures (18-25°C) to improve folding

  • Consider co-expression with archaeal chaperones if initial yields are low

For amplification of the MJ1588 gene, design primers with appropriate restriction sites based on the strategy used for MJ0438: "The PCR product containing the trm14 gene was digested with NdeI and XhoI, and inserted into the pet22b+ vector (Novagen) for expression of C-terminal His-tagged protein in Escherichia coli" .

What purification challenges are specific to hyperthermophilic archaeal proteins and how can they be addressed?

Purifying recombinant hyperthermophilic proteins presents unique challenges and opportunities:

ChallengeSolutionRationale
Improper folding in mesophilic hostsHeat treatment (65-70°C) post-lysisPrecipitates E. coli proteins while helping MJ1588 achieve native conformation
Protein aggregationInclude 5-10% glycerol in buffersPrevents hydrophobic interactions that lead to aggregation
Low solubilityAdd mild detergents (0.05% Triton X-100)Increases solubility without denaturing protein
Proteolytic degradationPerform purification steps at elevated temperatures (40-50°C)Denatures E. coli proteases while maintaining stability of target protein
Co-purification of contaminantsInclude heat step (75°C, 20 min) before final purificationExploits thermostability to remove persistent contaminants

A heat treatment step is particularly effective as demonstrated with Mj-FprA, which was successfully purified using affinity chromatography from M. jannaschii BM31 .

How can researchers optimize activity assays for an uncharacterized protein like MJ1588?

When developing activity assays for an uncharacterized protein like MJ1588, consider:

  • Temperature optimization: Conduct assays at 65-85°C to match M. jannaschii's physiological conditions

  • Buffer composition: Test multiple buffers with pH values accounting for temperature effects (pH optima shift at high temperatures)

  • Substrate screening: Employ metabolite libraries relevant to archaeal metabolism

Design a systematic screening approach based on:

  • Genomic context of MJ1588 to identify potential metabolic pathways

  • Structural predictions suggesting substrate-binding pockets

  • Homology to distant relatives with known functions

Include appropriate controls for spontaneous substrate degradation at high temperatures, as non-enzymatic reaction rates increase significantly at the temperatures optimal for M. jannaschii proteins.

How can genetic manipulation systems for M. jannaschii be utilized to study MJ1588 in vivo?

A genetic system for M. jannaschii has been developed that allows for chromosomal modification via homologous recombination . To study MJ1588 in vivo:

  • Design a suicide vector containing:

    • Upstream and downstream homologous regions flanking MJ1588

    • A modified version of MJ1588 with an affinity tag (e.g., 3xFLAG-twin Strep tag)

    • A selectable marker like Psla-hmgA cassette conferring mevinolin resistance

  • Transform linearized vector into M. jannaschii using heat shock method:

    • "M. jannaschii required a heat shock and not a treatment with a chemical such as polyethylene glycol and liposomes"

    • Verify transformation by PCR and sequencing

  • Express the tagged protein and analyze its:

    • Cellular localization

    • Protein-protein interactions via co-immunoprecipitation

    • Effect of gene knockout/overexpression on cellular physiology

This approach was successfully used to characterize Mj-FprA in M. jannaschii strain BM31, yielding 0.26 mg of purified protein per liter of culture .

What structural analysis techniques are most informative for hyperthermophilic proteins like MJ1588?

For structural characterization of hyperthermophilic proteins like MJ1588, employ multiple complementary techniques:

  • X-ray crystallography:

    • Perform crystallization trials at elevated temperatures (30-40°C)

    • Use sparse matrix screens optimized for thermophilic proteins

    • Include ligands identified in preliminary functional studies

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Particularly valuable for identifying regions of structural flexibility

    • Conduct exchange reactions at multiple temperatures (25°C and 70°C)

    • Compare dynamics with mesophilic homologs if available

  • Small-angle X-ray scattering (SAXS):

    • Obtain low-resolution structural information in solution

    • Compare structures at different temperatures to assess thermal stability

    • Analyze oligomerization states that may be temperature-dependent

  • Circular dichroism spectroscopy:

    • Monitor thermal unfolding/refolding to determine stability parameters

    • Measure spectra at increasing temperatures to identify conformational transitions

When analyzing data, focus on structural features that contribute to thermostability, as these may provide insights into the protein's evolutionary adaptations and functional constraints.

How can researchers distinguish between direct and indirect functional effects when studying MJ1588 in a heterologous system?

When characterizing MJ1588 in heterologous systems, differentiate direct from indirect effects using:

  • Complementation studies:

    • Express MJ1588 in organisms with deletions of functionally related genes

    • Assess specific phenotypic rescue rather than general growth effects

  • In vitro reconstitution:

    • Purify MJ1588 and potential interaction partners

    • Reconstitute putative complexes or pathways under controlled conditions

    • Use defined components to eliminate cellular variables

  • Structure-function analysis:

    • Create point mutations in predicted functional residues

    • Compare activities of wild-type and mutant proteins

    • Correlate specific structural elements with discrete functions

  • Time-resolved studies:

    • Use rapid kinetic techniques to establish reaction order

    • Identify intermediates to confirm direct catalytic roles

The characterization of Mj-FprA demonstrates the value of this approach: "The purified Mj-FprA protein was tested for the predicted activity by measuring the oxygen reduction activity employing F420H2 as the reductant... The apparent specific activity of Mj-FprA at 70°C with oxygen and F420H2 at concentrations of 20 and 40 μM, respectively, was 2,100 μmole/min/mg" .

How should researchers design experiments to account for the extreme temperature optima of M. jannaschii proteins?

Experimental design for hyperthermophilic proteins requires specialized approaches:

  • Temperature considerations:

    • Conduct enzymatic assays at multiple temperatures (60-90°C)

    • Use thermostable buffers (HEPES, phosphate) with minimal pH shift at high temperatures

    • Pre-incubate all reagents to target temperature before initiating reactions

  • Equipment modifications:

    • Use sealed reaction vessels to prevent evaporation

    • Employ temperature-controlled spectrophotometers or plate readers

    • Consider specialized high-temperature incubation chambers for longer experiments

  • Control reactions:

    • Include stability controls for substrates at high temperatures

    • Run parallel non-enzymatic control reactions to account for thermal degradation

    • Use internal standards to normalize for temperature effects on detection methods

  • Data interpretation:

    • Apply Arrhenius plots to distinguish enzymatic from non-enzymatic temperature effects

    • Consider temperature-dependent changes in substrate solubility and availability

    • Compare kinetic parameters across temperature ranges to identify optimal conditions

These approaches are crucial when working with proteins from organisms with growth temperatures around 85°C and doubling times as short as 26 minutes, as is the case with M. jannaschii .

What are the most reliable approaches for validating predicted functions of MJ1588?

For rigorous functional validation of MJ1588, employ multiple independent lines of evidence:

  • Biochemical validation:

    • Perform substrate screening based on bioinformatic predictions

    • Conduct structure-activity relationship studies with substrate analogs

    • Measure kinetic parameters under physiologically relevant conditions

  • Genetic approaches:

    • Create knockout or knockdown strains using the established genetic system

    • Perform complementation with wild-type and mutant variants

    • Use RNA-seq to identify transcriptional responses to gene perturbation

  • Structural validation:

    • Obtain co-crystal structures with substrates or products

    • Use site-directed mutagenesis to confirm catalytic residues

    • Compare structural features with functionally characterized homologs

  • Physiological relevance:

    • Determine expression patterns under different growth conditions

    • Assess metabolite profiles in wild-type versus mutant strains

    • Correlate protein activity with cellular phenotypes

This multi-faceted approach was effective for characterizing Trm14 from M. jannaschii, where biochemical assays confirmed its role in RNA methylation, consistent with structural predictions based on its THUMP domain and Rossmann fold .

How can researchers distinguish between archaeal-specific functions and conserved activities when studying MJ1588?

To differentiate between archaeal-specific and universally conserved functions:

  • Comparative genomics approach:

    • Analyze distribution of MJ1588 homologs across all domains of life

    • Identify archaeal-specific sequence motifs or structural elements

    • Determine if MJ1588 belongs to archaeal-specific metabolic pathways

  • Heterologous expression studies:

    • Express MJ1588 in bacterial and eukaryotic systems

    • Assess functionality across different cellular backgrounds

    • Identify host factors that influence activity

  • Evolutionary analysis:

    • Construct phylogenetic trees to determine if MJ1588 represents an ancient or derived function

    • Analyze selection pressures on different protein domains

    • Compare sequence conservation patterns in archaea versus other domains

  • Functional context:

    • Determine if MJ1588 interacts primarily with archaeal-specific cellular machinery

    • Assess its role in uniquely archaeal processes like methanogenesis

    • Evaluate its function in relation to archaeal cell membrane or wall components

This approach reveals whether MJ1588 represents a specialized adaptation to the extreme environments inhabited by M. jannaschii or a fundamental protein function conserved across evolutionary time.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.