Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

MJ1590 is encoded by the mj1590 gene (UniProt ID: Q58985) and spans 105 amino acids (1–105). Key features include:

PropertyValue/Description
Source OrganismMethanocaldococcus jannaschii (thermophilic archaeon)
Recombinant HostE. coli (primary), cell-free systems, yeast, or baculovirus (alternative hosts)
TagN-terminal His tag (for purification)
Purity≥90% (SDS-PAGE)
FormLyophilized powder; stabilized in Tris/PBS buffer with 6% trehalose
Amino Acid SequenceMRISPLIAGLIGGFTAAILQALFKVFPPPAYGICIACHTRDLVNWIINHLFGTTLGMALV SKAFPVLTVVGIFIGALITTFIYKETELKQTHSPVYWFHIRNFSY
Storage-20°C/-80°C (avoid freeze-thaw cycles); aliquot with 50% glycerol

Recombinant Production and Applications

MJ1590 is synthesized via recombinant DNA technology, primarily in E. coli, leveraging its His tag for affinity chromatography. Alternative hosts (e.g., yeast, baculovirus) are used for partial or modified variants .

Key Product Variants

Product CodeHostLengthPuritySource
RFL15399MFE. coliFull-length (1–105)≥90%Creative BioMart
MBS7038568Cell-freeFull-length≥85%MyBioSource
Partial variantsYeast/BaculovirusPartial sequence≥85%MyBioSource

Genomic and Functional Context

Methanocaldococcus jannaschii was the first archaeon to have its genome fully sequenced, revealing 1,738 protein-coding genes . MJ1590 is annotated as an "uncharacterized protein," indicating no confirmed biological role.

Potential Pathways and Challenges

  • Hypothesized Roles:

    • Metabolic Pathways: M. jannaschii is known for methanogenesis, amino acid biosynthesis, and extremophile-specific biochemistry . MJ1590 may participate in these processes, but direct evidence is lacking.

    • Protein Stability: As an extremophile, M. jannaschii produces heat-resistant enzymes. MJ1590’s stability at high temperatures could be a target for structural studies .

  • Research Gaps:

    • Interactions: No documented protein interactions or pathway memberships .

    • Expression Systems: Limited data on MJ1590’s native expression levels or regulatory mechanisms in M. jannaschii.

Handling and Reconstitution

  • Reconstitution: Dissolve in sterile deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Lyophilized protein is stable at -20°C/-80°C. Avoid repeated freeze-thaw cycles .

Research Applications

  • Structural Biology: Study of extremophile protein folding.

  • Enzyme Engineering: Potential use in high-temperature industrial processes (e.g., biofuel production).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize its inclusion in the manufacturing process.
Synonyms
MJ1590; Uncharacterized protein MJ1590
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1590
Target Protein Sequence
MRISPLIAGLIGGFTAAILQALFKVFPPPAYGICIACHTRDLVNWIINHLFGTTLGMALV SKAFPVLTVVGIFIGALITTFIYKETELKQTHSPVYWFHIRNFSY
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1590

STRING: 243232.MJ_1590

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in research?

Methanocaldococcus jannaschii is an autotrophic hyperthermophilic archaeon that thrives under extreme environmental conditions, including high pressure (>200 atm) and high temperatures (up to 94°C). It was the first archaeon to have its genome sequenced in 1996, making it a model organism for studying extremophiles and methanogenic archaea . Its significance lies in its unique metabolic pathways, which provide insights into early evolutionary processes, biochemistry under extreme conditions, and the role of methanogens in global carbon cycling .

What is known about the MJ1590 protein?

MJ1590 is an uncharacterized protein encoded by the Methanocaldococcus jannaschii genome. It consists of 105 amino acids and is expressed as a recombinant His-tagged protein in Escherichia coli . Despite being uncharacterized, its sequence and structural properties suggest potential roles in cellular metabolism or stress responses. The protein's purity (>90% as determined by SDS-PAGE) and stability under specific storage conditions make it suitable for experimental studies .

How can researchers experimentally characterize MJ1590?

Experimental characterization of MJ1590 involves several steps:

  • Protein purification: Recombinant MJ1590 can be purified using affinity chromatography due to its His tag .

  • Structural analysis: Techniques such as X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy can be used to determine its three-dimensional structure.

  • Functional assays: Enzyme activity assays or binding studies can be conducted to identify potential substrates or interaction partners.

  • Genetic studies: Knockout or overexpression studies in Methanocaldococcus jannaschii or model organisms can help elucidate its biological role.

What are the challenges associated with studying uncharacterized proteins like MJ1590?

Studying uncharacterized proteins poses several challenges:

  • Lack of functional information: Without known substrates or interaction partners, designing experiments becomes speculative.

  • Low expression levels: Achieving sufficient quantities of recombinant protein for analysis can be difficult.

  • Structural complexity: Proteins may adopt conformations that are challenging to resolve using standard techniques.

  • Functional redundancy: Proteins with overlapping functions may obscure phenotypic changes in genetic studies.

How does MJ1590 compare to other proteins in Methanocaldococcus jannaschii?

MJ1590 belongs to a large group of uncharacterized proteins in Methanocaldococcus jannaschii, which accounts for over a third of its genome . Comparative genomics and proteomics analyses reveal that many of these proteins share sequence motifs with known enzymes but lack experimental validation. MJ1590's amino acid sequence suggests potential conserved domains that warrant further investigation.

How can computational tools aid in predicting the function of MJ1590?

Computational tools such as sequence alignment algorithms (e.g., BLAST), structure prediction software (e.g., AlphaFold), and pathway reconstruction databases (e.g., BioCyc) can provide valuable insights into MJ1590's function . For example:

  • Sequence similarity: Identifying homologous proteins with known functions can suggest potential roles for MJ1590.

  • Structural modeling: Predicting tertiary structures can reveal active sites or binding pockets.

  • Pathway integration: Mapping MJ1590 onto metabolic pathways may identify missing links or "pathway holes" critical for cellular processes.

What experimental approaches can resolve conflicting data regarding MJ1590's function?

Resolving conflicting data requires a combination of approaches:

  • Cross-validation: Using multiple independent methods (e.g., biochemical assays, genetic studies) to confirm findings.

  • High-throughput screening: Testing a wide range of substrates or conditions to identify activity.

  • Mutagenesis studies: Creating site-directed mutants to pinpoint functional residues.

  • Comparative studies: Analyzing orthologs from related species to identify conserved functions.

How does MJ1590 contribute to our understanding of microbial "dark matter"?

Microbial "dark matter" refers to the vast number of genes in microbial genomes that remain functionally uncharacterized . Studying proteins like MJ1590 helps bridge gaps in our knowledge by:

  • Providing experimental validation for predicted functions.

  • Enhancing metabolic models through pathway reconstruction.

  • Identifying novel enzymes or biochemical activities unique to extremophiles.

What role does MJ1590 play in Methanocaldococcus jannaschii's metabolic network?

While MJ1590's specific role remains unknown, its inclusion in pathway-genome databases like MjCyc suggests potential involvement in metabolic processes unique to methanogens . Experimental characterization could reveal participation in stress responses, energy metabolism, or biosynthetic pathways essential for survival under extreme conditions.

How can researchers design experiments to test hypotheses about MJ1590's function?

Designing experiments involves:

  • Hypothesis formulation: Based on computational predictions or sequence motifs.

  • Experimental setup:

    • Expression and purification of recombinant MJ1590 .

    • Functional assays targeting predicted activities (e.g., enzymatic reactions).

    • Structural analysis to identify active sites or binding domains.

  • Data analysis:

    • Comparing results with computational predictions.

    • Evaluating reproducibility across different conditions.

What are best practices for working with recombinant proteins like MJ1590?

Best practices include:

  • Storage conditions: Maintaining stability by storing at -20°C/-80°C and avoiding repeated freeze-thaw cycles .

  • Reconstitution protocols: Using sterile water and adding glycerol for long-term storage .

  • Purity assessment: Confirming protein purity (>90%) through SDS-PAGE before experiments .

How can researchers ensure reproducibility when studying MJ1590?

Reproducibility can be ensured by:

  • Standardizing experimental protocols (e.g., purification methods).

  • Using controls (e.g., empty vectors, known proteins).

  • Conducting experiments in triplicate or more for statistical reliability.

What are the implications of studying uncharacterized proteins like MJ1590 for synthetic biology?

Uncharacterized proteins offer opportunities for synthetic biology by:

  • Expanding the repertoire of enzymes available for pathway engineering.

  • Providing insights into extremophile adaptations that could inform industrial applications.

  • Enabling the design of novel biosynthetic pathways based on unique activities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.