Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1644 (MJ1644)

Shipped with Ice Packs
In Stock

Description

Organism Background and Ecological Significance

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon first isolated from submarine hydrothermal vents in the East Pacific Rise, representing one of the most well-studied extremophiles in scientific research. The organism was originally classified as Methanococcus jannaschii before being reclassified based on phylogenetic studies as Methanocaldococcus jannaschii (Jones et al. 1984, Whitman 2002) . As a type strain (designated JAL-1, DSM 2661), M. jannaschii thrives in extreme environments characterized by high temperatures and anaerobic conditions, requiring cultivation at 80°C under specific medium conditions (Medium 282) .

The ecological significance of M. jannaschii stems from its adaptation to deep-sea hydrothermal environments, where it contributes to carbon cycling through methanogenesis. The organism demonstrates remarkable growth efficiency, with a minimum generation time of approximately 26 minutes under optimal conditions, making it one of the fastest-growing extremophiles documented . This rapid growth characteristic presents significant advantages for laboratory cultivation and experimental investigations despite the challenging growth requirements.

Genomic Features and Metabolic Capabilities

M. jannaschii possesses a distinctive genome consisting of a main chromosome and two additional extra-chromosomal elements. The complete genome sequence is available through GenBank with accession numbers L77117 (complete chromosome), L77118 (large extra-chromosomal element), and L77119 (small extra-chromosomal element) . The genomic architecture of this organism has provided valuable insights into archaeal biology and evolution.

Metabolic reconstruction studies have identified approximately 609 metabolic reactions organized into 113 distinct metabolic pathways in M. jannaschii, reflecting its specialized adaptation to extreme environments . The organism possesses several notable metabolic capabilities, including hydrogenase production and distinctive pathways for essential metabolic processes . Computational predictions using PathoLogic software have enabled the creation of MJCyc, a comprehensive database of M. jannaschii's enzymatic assignments and metabolic pathways that continues to serve as a valuable resource for researchers studying archaeal metabolism .

Analysis of the M. jannaschii genome has revealed unique features in pathway organization, including the identification of enzymes involved in sulfate assimilation, methionine synthesis, cobalamin biosynthesis, the mevalonate pathway, and polyamine synthesis . The organism also demonstrates distinctive evolutionary adaptations, such as a shikimate kinase (MJ1440) with no sequence similarity to bacterial or eukaryotic counterparts, highlighting the complex patterns of protein and metabolic network evolution in archaea .

Protein Family Classification and Functional Implications

While MJ1644 remains functionally uncharacterized, its sequence characteristics can be contextualized within broader protein family classifications. Though not explicitly linked to the Uncharacterized Protein Family 0016 (UPF0016) in the provided search results, the structural features of MJ1644 demonstrate similarities to other membrane proteins with conserved motifs .

The protein's amino acid composition suggests potential structural similarities to membrane proteins with multiple transmembrane spans. Many archaeal membrane proteins exhibit distinctive topological organizations that reflect adaptations to extreme environments. Some archaeal proteins contain paired clusters of three transmembrane spans with opposite orientations in the membrane, separated by loop regions . While direct evidence for such an arrangement in MJ1644 is not provided in the search results, the amino acid sequence contains features consistent with multiple membrane-spanning regions.

The exact function of MJ1644 remains to be experimentally determined, highlighting a significant knowledge gap in our understanding of M. jannaschii's proteome. This protein may participate in cellular processes specifically adapted to extreme conditions, potentially involving membrane integrity, transport functions, or signaling pathways critical for survival in hyperthermophilic environments.

Expression Systems and Production Methods

The recombinant full-length MJ1644 protein has been successfully expressed in E. coli expression systems, demonstrating the feasibility of heterologous production of this archaeal protein in bacterial hosts . This approach enables the production of sufficient quantities for biochemical and structural studies, facilitating further characterization of this uncharacterized protein.

The production method involves the expression of the full-length protein (amino acids 1-177) fused with an N-terminal histidine tag to facilitate purification . The recombinant protein corresponds to the UniProt ID Q59038, providing a standardized reference point for cross-database comparisons and further research . The successful expression in E. coli demonstrates compatibility with bacterial expression machinery despite the archaeal origin of the protein sequence.

Current Understanding within M. jannaschii Genomics

The study of MJ1644 should be positioned within the broader research context of M. jannaschii genomics and proteomics. The complete genome sequencing of M. jannaschii represented a significant milestone in archaeal genomics, providing insights into the unique adaptations of hyperthermophilic organisms . Computational metabolic reconstruction efforts have identified numerous pathways and enzymatic functions within this organism, though many proteins, including MJ1644, remain functionally uncharacterized .

Ongoing research into M. jannaschii's metabolism has revealed distinctive features such as the presence of unique enzymes in metabolic pathways like the shikimate pathway, where archaeal versions may differ significantly from bacterial or eukaryotic counterparts . Similar distinctive features might be expected for MJ1644, potentially representing archaeal-specific adaptations or functions that have yet to be fully characterized.

Potential Applications and Research Directions

The availability of recombinant MJ1644 protein opens several potential research directions. Structural studies using X-ray crystallography or nuclear magnetic resonance could elucidate the three-dimensional structure of this protein, potentially providing insights into its function. Functional characterization through biochemical assays might reveal enzymatic activities or binding partners that could clarify its role within M. jannaschii's cellular processes.

As a protein from a hyperthermophilic organism, MJ1644 might exhibit exceptional thermal stability, potentially offering applications in biotechnology where heat-stable proteins are advantageous. The study of uncharacterized proteins from extremophiles has previously revealed novel enzymatic activities and structural features with biotechnological applications, suggesting similar potential for MJ1644.

Comparative genomic approaches could identify potential homologs or functionally related proteins in other archaeal species, potentially clarifying the evolutionary conservation and functional significance of MJ1644. Such approaches might reveal conserved domains or motifs that could provide clues to the protein's function based on better-characterized relatives.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1644; Uncharacterized protein MJ1644
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1644
Target Protein Sequence
MIKMELKEAKYLGGIGAVLNLVSYAVGGILAIAGYVLILLALNKISKIFNDDEVFKKYLY GVVLWIIAVLIVIFAVGISFVSLSFIPLDYGLTAMSSFLVGVILFYILSVIGGYFIKKSY EKVSYYTGVDSFRICGLLYFIGTLLLIVIVGIIVIIVAQILEIVAYFSLPDDLKSEN
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1644

STRING: 243232.MJ_1644

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.