Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38 (MJECL38)

Shipped with Ice Packs
In Stock

Description

Introduction to MJECL38

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38 (MJECL38) is a protein derived from the archaeon Methanocaldococcus jannaschii. M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct. MJECL38 is referred to as an "uncharacterized protein," indicating that its specific function within the organism is not yet fully understood .

MJECL38 Characteristics

MJECL38 is a full-length protein consisting of 259 amino acids . The protein's amino acid sequence is as follows: MANMQSLTNIEVQRFHDCEWEYFKEFDDEFNKLWNEIEKTLGRDFINYLSAYFQKNLVYM LGKEFKLKLVVDTNIIFSQVLSYVTKGELPWILDFINNPFIELYAPQLIVDELKNKIENV LPKKCKKKNIDENKAKSKAIKIANIILSNIKIINDKKSNNWSKIAYNLIGHRDVKDIPFV TLALSLDTHGIITRDKDFKDQKIIKIWKVGEVKVVLTELSQGSFSFCIMNVTAPLAFKIC TSIIITILEIVTSIIKKTN .

Potential Research Applications

Recombinant MJECL38 is available for purchase for research purposes, often in the form of ELISA (Enzyme-Linked Immunosorbent Assay) kits . These kits can be used to detect and quantify MJECL38 in biological samples, aiding in research aimed at understanding its function and interactions .

Data Table: MJECL38 Properties

PropertyValue
OrganismMethanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Protein Length259 amino acids
UniProt Accession NO.Q60293
Expression Region1-259
StorageStore at -20℃, for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Future Research Directions

Further research is essential to fully understand the function of MJECL38. This could involve:

  • Structural studies: Determining the three-dimensional structure of the protein through X-ray crystallography or NMR spectroscopy could provide insights into its function.

  • Interaction studies: Identifying the proteins and other molecules that MJECL38 interacts with in the cell can help reveal its role in cellular pathways.

  • Functional assays: Developing assays to test the activity of MJECL38 under various conditions can help determine its enzymatic or regulatory functions.

  • Genetic studies: Mutating the gene encoding MJECL38 and observing the effects on the organism's phenotype can provide clues about its function.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MJECL38; Uncharacterized protein MJECL38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJECL38
Target Protein Sequence
MANMQSLTNIEVQRFHDCEWEYFKEFDDEFNKLWNEIEKTLGRDFINYLSAYFQKNLVYM LGKEFKLKLVVDTNIIFSQVLSYVTKGELPWILDFINNPFIELYAPQLIVDELKNKIENV LPKKCKKKNIDENKAKSKAIKIANIILSNIKIINDKKSNNWSKIAYNLIGHRDVKDIPFV TLALSLDTHGIITRDKDFKDQKIIKIWKVGEVKVVLTELSQGSFSFCIMNVTAPLAFKIC TSIIITILEIVTSIIKKTN
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_ECL38

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How should recombinant MJECL38 be stored and handled in the laboratory?

For optimal stability and activity, recombinant MJECL38 should be stored at -20°C for regular use, and at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol. Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein degradation and loss of activity. Working aliquots can be maintained at 4°C for up to one week. For long-term storage, aliquoting the protein into single-use volumes is strongly recommended to minimize freeze-thaw damage .

What expression systems are typically used for producing recombinant MJECL38?

While specific expression system information for MJECL38 is limited in the provided literature, similar archaeal proteins like the MJ0953 protein from M. jannaschii are successfully expressed in E. coli with N-terminal His-tags . For MJECL38 expression, researchers typically use bacterial expression systems with appropriate tags to facilitate purification. When designing an expression strategy, considerations should include the thermostability of the native protein (as M. jannaschii is hyperthermophilic) and potential requirements for archaeal-specific post-translational modifications .

How should researchers design experiments to characterize the function of MJECL38?

A comprehensive experimental design for characterizing MJECL38 should follow these methodological steps:

Experimental ApproachKey TechniquesExpected Outcomes
Sequence analysisBioinformatics (homology modeling, phylogenetic analysis)Potential functional domains, evolutionary relationships
Structural studiesX-ray crystallography, NMR, cryo-EMProtein folding patterns, active sites
Biochemical assaysEnzyme activity assays, substrate screeningPotential enzymatic functions
Protein-protein interactionsCo-immunoprecipitation, yeast two-hybridInteraction partners
Genetic approachesGene knockout/complementation studiesIn vivo function

When designing these experiments, researchers should implement true experimental designs with appropriate controls whenever possible. For cases where true experimental approaches aren't feasible (such as in vivo studies in the native organism), quasi-experimental designs may be necessary, but researchers should account for potential confounding variables .

What specific considerations should be made when designing thermal stability experiments for MJECL38?

Given that M. jannaschii is a hyperthermophilic organism that thrives at temperatures around 85°C, experimental designs for thermal stability studies of MJECL38 require special considerations:

  • Temperature range selection should include both standard laboratory temperatures (20-37°C) and elevated temperatures (60-95°C)

  • Buffer systems must maintain pH stability across the entire temperature range

  • Control proteins should include both mesophilic homologs and known thermostable proteins

  • Multiple thermal stability assays should be employed in parallel:

    • Differential scanning calorimetry (DSC)

    • Circular dichroism (CD) spectroscopy with temperature ramping

    • Activity assays at various temperatures

    • Fluorescence-based thermal shift assays

The experimental design should include technical replicates (minimum n=3) and multiple biological replicates to ensure reproducibility and validity of results .

How can researchers determine if MJECL38 has RNA methyltransferase activity similar to other characterized M. jannaschii proteins?

Given that some characterized proteins from M. jannaschii function as RNA methyltransferases (such as the MJ0438 gene product which encodes a novel S-adenosylmethionine-dependent methyltransferase involved in m2G6 formation in tRNA), researchers investigating potential similar activity in MJECL38 should employ a systematic approach:

  • Bioinformatic analysis to identify potential methyltransferase domains or motifs

  • In vitro methylation assays using:

    • Purified recombinant MJECL38

    • 14C or 3H-labeled S-adenosylmethionine (SAM) as methyl donor

    • Various RNA substrates (tRNA, rRNA, mRNA)

  • Product analysis via:

    • Thin-layer chromatography

    • HPLC coupled with mass spectrometry

    • RNA sequencing methods optimized for methylation detection

For identifying specific methylated positions, researchers should employ a quasi-experimental design comparing wild-type substrates to in vitro methylated substrates, with appropriate controls including known methyltransferases from M. jannaschii (such as the Trm14 enzyme) .

What strategies should be employed to resolve data contradictions when studying the biochemical properties of MJECL38?

When encountering contradictory results in MJECL38 research, implement this methodological framework:

  • Systematically evaluate experimental variables that might explain contradictions:

    • Protein preparation methods (tags, purification protocols)

    • Buffer compositions and pH conditions

    • Temperature and salt concentration differences

    • Substrate quality and preparation methods

  • Design cross-validation experiments using multiple independent techniques to measure the same property

  • Implement a factorial experimental design to identify interaction effects between variables

  • Consider biological explanations for contradictions:

    • Allosteric regulation

    • Post-translational modifications

    • Protein oligomerization states

    • Substrate-induced conformational changes

In all cases, maintain rigorous documentation of experimental conditions, employ statistical analyses appropriate for the experimental design, and ensure replication with clear reporting of both technical and biological variability .

What are the appropriate controls and validation steps when studying protein-protein interactions involving MJECL38?

When investigating protein-protein interactions of MJECL38, implement these methodological controls and validation steps:

  • Primary interaction screening should employ at least two independent methods:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid (Y2H) or bacterial two-hybrid systems

    • Proximity-dependent biotin labeling (BioID or APEX)

  • Essential controls include:

    • Tag-only controls to identify false positives due to tag interactions

    • Unrelated archaeal protein controls to identify non-specific binding

    • Reciprocal tagging and pulldowns (tag both MJECL38 and putative interactors)

  • Validation of primary hits must include:

    • Co-immunoprecipitation using antibodies against native proteins when available

    • Direct binding assays (surface plasmon resonance, microscale thermophoresis)

    • Functional assays demonstrating biological relevance of interaction

  • For thermophilic interactions specific to M. jannaschii, perform interaction studies at physiologically relevant temperatures (80-85°C) when methodologically feasible .

How should researchers approach the functional comparison of MJECL38 with homologs from other archaeal species?

A comprehensive approach to functional comparison requires:

  • Identify true homologs through:

    • Reciprocal BLAST analysis

    • Domain architecture comparison

    • Phylogenetic tree construction

    • Synteny analysis of genomic context

  • Recombinant expression and purification:

    • Use identical expression systems and purification protocols

    • Include the same tags in the same position

    • Verify protein folding through circular dichroism or thermal shift assays

  • Parallel functional characterization:

    • Employ identical assay conditions for direct comparison

    • Create a temperature matrix (25-95°C) to account for thermal adaptation

    • Test substrate specificity using consistent substrate panels

  • In vivo complementation studies:

    • Express homologs in a common host system

    • Quantify the degree of functional complementation

    • Use site-directed mutagenesis to identify critical residues

This methodological approach combines elements of true experimental design with comparative analysis. Researchers should report detailed methods and consider the limitation that different archaeal species have evolved under different selective pressures .

What are the main technical challenges in obtaining sufficient quantities of functionally active MJECL38, and how can they be overcome?

Researchers face several technical challenges when producing active MJECL38:

ChallengeCauseSolution Approach
Poor expression yieldCodon bias, toxicity to hostOptimize codon usage for expression host; use tightly regulated inducible systems
Inclusion body formationProtein misfolding at low temperaturesExpress at higher temperatures (30-37°C); use solubility-enhancing tags (SUMO, MBP)
Loss of native structureAbsence of archaeal chaperonesCo-express with archaeal chaperones; refold from inclusion bodies
Aggregation during purificationExposure of hydrophobic surfacesInclude stabilizing additives (glycerol, arginine); optimize buffer conditions
Heterogeneous productIncomplete translationUse C-terminal tags to ensure only full-length proteins are purified

For proteins from hyperthermophiles like M. jannaschii, expressing in E. coli at elevated temperatures (37°C) and including additional heat steps during purification (50-60°C) can help eliminate host proteins while maintaining MJECL38 solubility. Consider using specialized extremophile-derived expression systems when available .

How can researchers effectively utilize quasi-experimental designs when studying MJECL38 in contexts where randomization is not possible?

When true experimental designs are impractical for MJECL38 research (such as in ecological studies of M. jannaschii or when investigating natural variants), quasi-experimental approaches can be effectively implemented by:

  • Employing regression discontinuity designs when studying threshold effects:

    • Use naturally occurring temperature gradients in hydrothermal vents

    • Analyze protein expression patterns across these gradients

    • Identify threshold points where expression significantly changes

  • Implementing nonequivalent groups design:

    • Compare closely related Methanocaldococcus species with and without MJECL38 homologs

    • Control for phylogenetic relationships

    • Match organisms based on ecological niches and growth conditions

  • Addressing threats to internal validity:

    • Control for history effects by collecting all samples simultaneously

    • Minimize instrumentation effects through calibration controls

    • Account for selection effects through careful sample matching

  • Enhancing external validity:

    • Sample across multiple environmental conditions

    • Include biological and technical replicates

    • Validate findings using complementary approaches

These strategies allow researchers to maximize the rigor of their studies even when randomization is not possible in field conditions or when studying naturally occurring variations .

What emerging technologies might advance our understanding of MJECL38 function in the next five years?

Several cutting-edge technologies show promise for elucidating MJECL38 function:

  • AlphaFold2 and related AI protein structure prediction tools:

    • Generate high-confidence structural models of MJECL38

    • Identify potential active sites and binding pockets

    • Guide rational mutagenesis studies

  • Cryo-electron microscopy advances:

    • Resolve structures of MJECL38 in complex with interaction partners

    • Visualize conformational changes under different conditions

    • Achieve near-atomic resolution without crystallization

  • Single-molecule techniques:

    • Measure MJECL38 conformational dynamics in real-time

    • Quantify binding kinetics with potential substrates

    • Observe individual catalytic cycles

  • CRISPR-based technologies adapted for archaeal systems:

    • Generate precise gene knockouts in M. jannaschii

    • Create reporter systems for monitoring protein activity

    • Perform high-throughput functional screening

  • Integrated multi-omics approaches:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Generate comprehensive interaction networks

    • Identify physiological pathways involving MJECL38 .

How might the study of MJECL38 contribute to our understanding of archaeal evolution and extremophile adaptation?

MJECL38 research can provide valuable insights into archaeal evolution and adaptation through these research avenues:

  • Comparative genomics across the archaeal domain:

    • Track the evolutionary history of MJECL38 homologs

    • Identify patterns of gene conservation in thermophiles

    • Correlate sequence variations with habitat temperature

  • Structure-function relationship studies:

    • Identify thermostability-conferring features of MJECL38

    • Compare with mesophilic homologs when available

    • Investigate the molecular basis of protein adaptation to extreme conditions

  • Horizontal gene transfer investigation:

    • Determine if MJECL38 shows evidence of HGT between archaea and bacteria

    • Assess functional convergence in thermophilic organisms

    • Evaluate the role of mobile genetic elements in MJECL38 evolution

  • Systems biology perspective:

    • Map MJECL38 interactions within the broader archaeal cellular network

    • Identify its position in stress response pathways

    • Determine if it functions within archaeal-specific biological processes

This research contributes to the broader understanding of how life adapts to extreme environments and may reveal novel molecular mechanisms relevant to both evolutionary biology and biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.