Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECS05 (MJECS05)

What is MJECS05 and what are its basic structural characteristics?

MJECS05 is an uncharacterized protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii. It consists of 144 amino acids with the sequence: MESKEYRKLEYNYKAFLIFSKVAMLTFLTVGIGAIFTPQTYPIMPTIGFIVVAGIVSLIGMTIGALIIHQQYETLPANEKLEFKQKLLPEAYYICIELFGYGSLVLLYNTFTSNNPTLCVMSLLMAGLFILVVLVIWYFGYKSY . Analysis of this sequence suggests multiple transmembrane domains, indicating it likely functions as a membrane protein. Research approaches should consider its hydrophobic nature when designing purification and characterization experiments.

What expression systems are suitable for producing recombinant MJECS05?

While MJECS05 is natively expressed in M. jannaschii, recombinant expression is typically performed in E. coli systems for research purposes . When designing expression experiments, researchers should consider:

• Using a His-tag fusion for affinity purification

• Selecting appropriate E. coli strains optimized for membrane protein expression

• Implementing temperature control strategies to mitigate protein aggregation

• Adjusting induction conditions for optimal expression

For experiments requiring highly pure protein, a combination of affinity chromatography and size exclusion chromatography is recommended to achieve >90% purity as verified by SDS-PAGE .

How should recombinant MJECS05 be stored for optimal stability?

Recombinant MJECS05 is typically supplied as a lyophilized powder and requires proper storage protocols to maintain activity . Recommended storage conditions include:

• Store lyophilized protein at -20°C/-80°C upon receipt

• After reconstitution, prepare working aliquots to avoid repeated freeze-thaw cycles

• For short-term use, store working aliquots at 4°C for up to one week

• For reconstituted protein intended for long-term storage, add glycerol to 50% final concentration before storing at -20°C/-80°C

• Avoid repeated freeze-thaw cycles which can lead to protein denaturation and loss of activity

What reconstitution procedures are recommended for lyophilized MJECS05?

For optimal reconstitution of lyophilized MJECS05, follow these methodological steps:

• Briefly centrifuge the vial to bring contents to the bottom before opening

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• For long-term storage, add glycerol to 5-50% final concentration (50% is standard)

• Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Verify protein concentration using spectrophotometric methods or Bradford assay

What experimental design approaches are most suitable for functional characterization of MJECS05?

Given that MJECS05 is an uncharacterized protein, systematic experimental design is essential for functional elucidation. Recommended approaches include:

• Independent and Dependent Variable Definition:

  • Independent variables: Protein concentration, temperature, pH, binding partners

  • Dependent variables: Activity metrics, binding affinities, structural changes

• Control of Extraneous Variables:

  • Temperature stability considerations for a hyperthermophilic protein

  • Buffer composition effects on protein stability and activity

  • Presence of potential cofactors or metal ions

• Randomization and Replication:

  • Implement true experimental designs with proper randomization

  • Perform sufficient biological and technical replicates

  • Use statistical power analysis to determine appropriate sample sizes

• Comparative Approaches:

  • Parallel analysis with characterized homologs from related archaeal species

  • Structure-function relationship studies using site-directed mutagenesis

  • Comparative genomics to identify potential functional relationships

How can genetic systems for M. jannaschii be adapted for studying MJECS05 in vivo?

Recent advances in M. jannaschii genetic systems can be adapted for studying MJECS05 in its native context:

• Construction of Expression Vectors:

  • Design suicide plasmids containing upstream and 5'-end coding regions of MJECS05

  • Include appropriate affinity tags (e.g., 3xFLAG-twin Strep tag) for purification

  • Incorporate strong promoters (e.g., modified P* promoter) for overexpression

• Transformation Protocol:

  • Linearize the construct before transformation

  • Optimize transformation conditions for M. jannaschii

  • Select transformants using appropriate selection markers (e.g., mevinolin resistance)

  • Verify successful integration through PCR-based analysis of chromosomal DNA

• Protein Purification Strategy:

  • Lyse cells under conditions optimized for membrane proteins

  • Utilize affinity chromatography (e.g., Streptactin XT superflow column)

  • Elute with appropriate agents (e.g., 10 mM D-biotin for Strep-tagged proteins)

  • Verify purification by SDS-PAGE, Western blot, and mass spectrometric analysis

What approaches can resolve the contradiction between membrane association and functional analysis of MJECS05?

The hydrophobic nature of MJECS05 presents challenges for functional characterization. Researchers should consider these methodological approaches:

How can comparative genomics and evolutionary analysis inform MJECS05 research?

As an uncharacterized protein from an evolutionarily deep-branching archaeon, MJECS05 research benefits from comparative approaches:

• Phylogenetic Analysis:

  • Identify homologs across archaeal and bacterial domains

  • Construct phylogenetic trees to understand evolutionary relationships

  • Map conserved residues to predict functionally important regions

• Structural Prediction:

  • Use homology modeling if close structural homologs exist

  • Apply ab initio modeling approaches for novel fold prediction

  • Validate predictions through targeted mutagenesis experiments

• Genomic Context Analysis:

  • Examine neighboring genes in the M. jannaschii genome

  • Identify co-occurrence patterns across species

  • Look for gene fusion events that might indicate functional relationships

What variables should be controlled when designing experiments with MJECS05?

When working with MJECS05, careful experimental design requires controlling these variables:

Proper experimental design should include randomization and sufficient replication to ensure statistical validity of results . For hyperthermophilic proteins like MJECS05, temperature control is particularly critical during all experimental procedures.

What are the key considerations for applying genetic engineering to study MJECS05?

When applying genetic approaches to study MJECS05, researchers should consider:

• Homologous Recombination Efficiency:

  • Design constructs with sufficiently long homology arms (>500 bp)

  • Optimize transformation conditions for M. jannaschii

  • Include appropriate selection markers for screening

• Expression Control:

  • Select appropriate promoters based on desired expression levels

  • Consider inducible systems for temporal control

  • Account for codon usage differences when expressing in heterologous systems

• Tag Selection and Placement:

  • Consider the impact of N-terminal vs. C-terminal tags on protein function

  • Use small tags to minimize interference with protein function

  • Include tag removal options (e.g., protease sites) for subsequent analyses

How should researchers approach method development for functional assays of MJECS05?

Developing functional assays for an uncharacterized protein requires systematic methodology:

• Bioinformatic-Guided Hypothesis Development:

  • Use sequence analysis to predict potential functional domains

  • Identify conserved motifs that suggest enzymatic activity

  • Compare with characterized proteins for functional clues

• High-Throughput Screening Approaches:

  • Design activity screens based on predicted function

  • Test interactions with various substrates and binding partners

  • Employ label-free technologies to avoid interference with protein function

• Validation Strategy:

  • Confirm results using orthogonal methods

  • Include positive and negative controls in all assays

  • Perform site-directed mutagenesis of predicted active sites to verify functional roles

How should researchers approach contradictory results when characterizing MJECS05?

When facing contradictory results in MJECS05 research, apply these methodological approaches:

• Systematic Troubleshooting:

  • Verify protein integrity through multiple methods (SDS-PAGE, mass spectrometry)

  • Examine experimental conditions for potential variables affecting outcomes

  • Consider protein stability issues unique to hyperthermophilic proteins

• Reconciliation Strategies:

  • Test conditions that bridge contradictory experimental setups

  • Develop hypothesis-driven experiments to specifically address contradictions

  • Consider that apparent contradictions may reveal novel regulatory mechanisms

• Collaborative Verification:

  • Engage multiple laboratories to independently verify findings

  • Use complementary techniques to examine the same question

  • Establish standardized protocols to minimize methodology-based variations

What statistical approaches are appropriate for analyzing MJECS05 experimental data?

For robust analysis of MJECS05 experimental data, researchers should:

• Select Appropriate Statistical Tests:

  • Use parametric tests only when normality assumptions are met

  • Apply non-parametric alternatives when data distributions are skewed

  • Consider mixed-effects models for experiments with multiple variables

• Account for Multiple Testing:

  • Apply appropriate corrections (Bonferroni, False Discovery Rate)

  • Pre-register analysis plans when possible

  • Distinguish between exploratory and confirmatory analyses

• Apply Rigorous Validation:

  • Use cross-validation for predictive models

  • Include biological and technical replicates in experimental design

  • Report effect sizes alongside statistical significance

What emerging technologies might advance understanding of MJECS05 function?

Future research on MJECS05 could benefit from these emerging approaches:

• Cryo-EM Analysis:

  • Apply single-particle cryo-EM for structural determination

  • Use cryo-electron tomography to study MJECS05 in native membrane context

  • Combine with computational methods for high-resolution structure determination

• Integrative Structural Biology:

  • Combine multiple structural techniques (X-ray crystallography, NMR, SAXS)

  • Use cross-linking mass spectrometry to identify interaction surfaces

  • Apply molecular dynamics simulations to explore conformational states

• Systems Biology Approaches:

  • Perform global interactome studies to identify binding partners

  • Use metabolomic profiling to identify potential substrates

  • Apply network analysis to position MJECS05 in cellular pathways