Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECS10 (MJECS10)

Shipped with Ice Packs
In Stock

Description

Genomic and Metabolic Context

  • Genome Position: MJECS10 is encoded by the mjecs10 gene, part of the 1.66 Mb circular chromosome of M. jannaschii .

  • Functional Status: Classified as "uncharacterized" despite extensive re-annotation efforts, which assigned enzymatic roles to ~35% of the organism’s proteome .

  • Evolutionary Significance: M. jannaschii was the first archaeon sequenced (1996), revealing deep evolutionary branches in the tree of life .

3.1. Technical Utility

  • Recombinant Production: MJECS10 is marketed for research applications (e.g., structural studies or antibody development), though its biological role remains unknown .

  • Extremophile Adaptations: M. jannaschii thrives at 94°C and >200 atm pressure, making MJECS10 a candidate for studying thermostable protein mechanisms .

3.2. Challenges in Characterization

  • Limited Functional Data: Despite M. jannaschii’s status as a model archaeon, ~34% of its genome lacks functional annotation, including MJECS10 .

  • Pathway Gaps: Public databases (e.g., BioCyc) list MJECS10 as lacking assigned pathways or interactions .

Future Directions

  • Proteomic Studies: Structural elucidation (e.g., crystallography) could reveal MJECS10’s role in methanogenesis or stress response.

  • Comparative Genomics: Cross-referencing with homologs in related methanogens may identify conserved domains or metabolic links .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag is required, please inform us; we will prioritize its inclusion.
Synonyms
MJECS10; Uncharacterized protein MJECS10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJECS10
Target Protein Sequence
MNFKKVSNMPDEIICNFYVNISYLEISATYDSKNKRYSLSSKTGNFNVGVKGFEKLLSIF EKIGHVMKINEKTYKIIIQNKILNLKHLYSKKNKTHTLEILDEYNNLMKLSGKKLIDVAL QLFKTFKINENIENSLNVKKTENDIQIINNNQNLKIEENINDSKTKENDNKCYREIIDRV LKSRSEQLFIENLENIPPKSVIYSITGAFSFIFGLGVLCETLESGKIRWKAIILGFIILI LILAIVNYLMMKEKNVDEHEYNIPTKLMEDVYTTDCENFPCGYFPK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_ECS10

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the first steps in characterizing an uncharacterized protein like MJECS10?

Characterization of an uncharacterized protein should begin with computational analysis before experimental work. The initial approach involves in silico characterization using bioinformatics tools to predict physicochemical properties, subcellular localization, and potential functions. This includes analyzing the amino acid sequence for conserved domains, determining physicochemical properties (molecular weight, isoelectric point, instability index), and predicting the protein's secretory nature . For MJECS10, researchers should first employ tools like BLAST for homology searches, ExPASy ProtParam for physicochemical characterization, and TMHMM for membrane topology prediction. These computational approaches provide foundational data that guide subsequent experimental design and resource allocation.

How can I predict the potential function of MJECS10 using in silico methods?

In silico function prediction for MJECS10 should employ a multi-faceted approach including:

  • Conserved domain analysis using CDD, Pfam, and InterProScan to identify functional domains

  • Comparative homology analysis against characterized proteins

  • Structure prediction using tools like I-TASSER or AlphaFold

  • Binding-site analysis to identify potential ligand interaction sites

  • Pathway analysis to predict metabolic or signaling pathway involvement

For MJECS10, these computational methods can reveal potential functions based on structural similarities with characterized proteins, even when sequence homology is limited. The approach should also include GO term enrichment analysis to categorize potential functions into molecular function, biological process, and cellular component categories, providing a comprehensive functional prediction framework.

What expression systems are most suitable for recombinant production of MJECS10?

For recombinant production of thermophilic archaeal proteins like MJECS10 from M. jannaschii (an extremophile that grows optimally at 85°C), selecting an appropriate expression system is critical. While E. coli remains the most common host due to its ease of manipulation, specialized expression vectors containing thermostable selection markers and heat-shock promoters may enhance expression levels . For proper folding of MJECS10, consider using:

  • E. coli strains engineered for rare codon usage common in archaea

  • Temperature-modified expression protocols with post-induction temperatures around 42°C

  • Specialized chaperone co-expression systems like GroEL/GroES

  • Cell-free protein synthesis systems using thermophilic components

The choice should be guided by the protein's predicted characteristics, such as presence of disulfide bonds, membrane association, or cofactor requirements, which can be initially assessed through in silico analysis of the amino acid sequence.

How should I design experiments to validate predicted functions of MJECS10?

Experimental validation of MJECS10's predicted functions should follow a systematic approach:

  • Recombinant expression and purification under conditions that maintain native conformation

  • Biochemical assays based on predicted functional categories (e.g., enzymatic activity, binding assays)

  • Protein interaction studies using pull-downs, two-hybrid systems, or co-immunoprecipitation

  • Structural analysis through X-ray crystallography, NMR, or cryo-EM

  • In vivo functional studies in model organisms or deletion/complementation studies

The experimental design should incorporate proper controls and validate findings through multiple independent methodologies. For example, if in silico analysis suggests a potential role in DNA binding, experiments should include both in vitro DNA binding assays and in vivo chromatin immunoprecipitation studies to confirm this function in a biological context.

What methods can be used to study gene expression patterns of MJECS10 in different conditions?

For studying MJECS10 gene expression patterns, researchers can employ several complementary techniques:

  • Quantitative PCR (qPCR) for targeted analysis of MJECS10 expression

  • RNA-Seq for genome-wide expression profiling

  • Microarray analysis for comparative expression studies across different conditions

  • Reporter gene assays to study promoter activity

When designing expression studies, consider testing multiple environmental conditions relevant to M. jannaschii's natural habitat, including:

ConditionParameter RangeRelevance
Temperature60-95°CM. jannaschii is hyperthermophilic
Pressure1-200 atmNative deep-sea hydrothermal environment
pH5.5-7.0Optimal growth pH range
Nutrient availabilityVariousMetabolic response patterns

For validation, quantitative PCR can be used to confirm results from high-throughput methods, as demonstrated in studies on other organisms . Expression data should then be analyzed using appropriate statistical methods to identify significant changes across conditions.

How can I determine the subcellular localization of MJECS10?

Determining the subcellular localization of MJECS10 involves both computational prediction and experimental verification:

  • In silico prediction using tools like PSORTb, CELLO, and SignalP

  • Fluorescent protein tagging (GFP fusion) with appropriate thermostable variants

  • Immunolocalization using specific antibodies

  • Subcellular fractionation followed by Western blotting

  • Mass spectrometry analysis of isolated cellular compartments

For archaeal proteins like MJECS10, consider M. jannaschii's unique cellular architecture when interpreting results. The lack of organelles in archaea means localization is primarily categorized as cytoplasmic, membrane-associated, or secreted. Prediction of membrane helices using tools like TMHMM can provide initial indications of membrane association . For experimental validation in thermophiles, traditional GFP may not be suitable due to temperature sensitivity, so thermostable fluorescent protein variants should be employed.

How can structural genomics approaches help characterize MJECS10?

Structural genomics approaches offer powerful insights for uncharacterized proteins like MJECS10:

  • High-throughput structure determination via X-ray crystallography or NMR

  • Integrative modeling using AlphaFold or RoseTTAFold for structure prediction

  • Structure-based function prediction through binding site analysis

  • Molecular dynamics simulations to understand protein flexibility and interactions

  • Structure-guided mutagenesis to test functional hypotheses

The structural information obtained can reveal functional sites not apparent from sequence analysis alone. For thermophilic proteins like MJECS10, structural studies can also provide insights into thermostability mechanisms, such as increased salt bridges, hydrophobic interactions, or disulfide bonds. Binding site prediction algorithms can identify potential ligand pockets, which can then guide virtual screening approaches to identify potential binding partners or substrates.

What comparative genomics approaches are useful for understanding MJECS10?

Comparative genomics offers valuable insights for uncharacterized proteins by examining evolutionary context:

  • Phylogenetic profiling to identify co-evolved gene clusters

  • Genomic context analysis to identify operons or functionally related genes

  • Comparative analysis across thermophilic archaea to identify conserved domains

  • Evolutionary rate analysis to identify functionally constrained regions

How should I address contradictory results when characterizing MJECS10?

When facing contradictory results in MJECS10 characterization, a systematic approach is essential:

  • Examine methodological differences between studies (expression systems, purification methods, assay conditions)

  • Consider context-dependent functions (temperature, pH, cofactors, interacting partners)

  • Analyze species-specific variations if comparing to homologs

  • Review whether differences are due to incomplete context specification

Contradictions in protein characterization often stem from differences in experimental conditions, particularly for proteins from extremophiles which may behave differently under standard laboratory conditions versus their native environments. As noted in biomedical literature analysis, many apparent contradictions result from underspecified contexts, including differences in experimental conditions and environmental phenomena . Document all experimental parameters carefully, including buffer composition, temperature, and presence of potential cofactors when reporting results to facilitate accurate comparison between studies.

What are the best approaches for identifying potential interaction partners of MJECS10?

Identifying interaction partners for MJECS10 requires considering its thermophilic nature:

  • Affinity purification coupled with mass spectrometry (AP-MS) using thermostable tags

  • Yeast two-hybrid screening adapted for high-temperature proteins

  • Protein microarrays containing thermostable controls

  • In silico prediction of protein-protein interactions

  • Cross-linking mass spectrometry (XL-MS) for capturing transient interactions

When designing interaction studies, stability of the interaction under experimental conditions is crucial. For thermophilic proteins like MJECS10, interactions may be optimally detected at elevated temperatures. Consider developing a thermophilic two-hybrid system or performing pull-down experiments at temperatures that better approximate M. jannaschii's native environment. Computational approaches can also provide preliminary interaction predictions by analyzing co-expression patterns, domain interactions, and evolutionary conservation .

How can I evaluate the potential role of MJECS10 in M. jannaschii stress response?

To evaluate MJECS10's potential role in stress response:

  • Analyze gene expression under various stress conditions (heat shock, oxidative stress, nutrient limitation)

  • Compare expression patterns with known stress response genes

  • Perform deletion or knockdown studies where possible

  • Examine protein abundance and modification changes under stress conditions

Design experiments that test MJECS10 expression across a matrix of stress conditions relevant to M. jannaschii's natural habitat, including temperature fluctuations, pressure changes, and exposure to toxic compounds. RNA-Seq or microarray approaches can reveal co-expression patterns with known stress response genes . For validation, quantitative PCR can confirm expression changes, while proteomics approaches can determine if post-translational modifications occur under stress conditions.

What techniques should I use to determine if MJECS10 has enzymatic activity?

To investigate potential enzymatic activity of MJECS10:

  • In silico prediction of catalytic sites using tools like CSA-Pred or POOL

  • High-throughput screening against diverse substrate libraries

  • Activity-based protein profiling using chemical probes

  • Coupled enzyme assays for detecting common reaction products (ATP, NADH)

  • Metabolite profiling in knockout/overexpression systems

Start with computational prediction of potential catalytic residues and substrate binding pockets to narrow down potential enzymatic functions. For thermophilic enzymes like those from M. jannaschii, conduct assays at elevated temperatures (60-90°C) to capture optimal activity. Consider substrate promiscuity in initial screens, as many uncharacterized proteins may have broad specificity or moonlighting functions. Document reaction conditions carefully, including buffer composition, metal cofactors, and temperature, as these can significantly impact enzymatic activity in hyperthermophiles .

How can I integrate multi-omics data to better understand MJECS10 function?

Integrating multi-omics data provides a comprehensive view of MJECS10 function:

  • Combine transcriptomic, proteomic, and metabolomic data sets

  • Apply network analysis to identify functional modules

  • Use machine learning approaches to identify patterns across data types

  • Perform pathway enrichment analysis across integrated datasets

  • Visualize integrated data using tools like Cytoscape or R packages

For effective integration, standardize experimental conditions across omics platforms and use appropriate normalization methods. Statistical approaches like canonical correlation analysis can identify relationships between different data types. When analyzing data from thermophiles like M. jannaschii, consider how temperature affects each data type differently – transcript abundance may not directly correlate with protein abundance due to differences in RNA and protein stability at high temperatures .

What computational tools are most effective for predicting post-translational modifications in MJECS10?

For predicting post-translational modifications (PTMs) in archaeal proteins like MJECS10:

  • NetPhos, PhosphoSite Plus, or MusiteDeep for phosphorylation

  • NetGlycate for glycosylation

  • SUMOsp for SUMOylation

  • NetAcet for acetylation

  • GPS-PAIL for archaeal-specific modifications

While applying these tools, consider the unique biochemistry of archaea, which may have distinct PTM patterns compared to bacteria or eukaryotes. Archaeal proteins often feature unique modifications like N-glycosylation with unusual sugars and methylation patterns. Verify computational predictions using techniques such as mass spectrometry with enrichment protocols adapted for thermostable proteins. When analyzing PTMs in thermophiles, consider how these modifications might contribute to protein thermostability rather than just regulation .

How should I approach resolving contradictory structural predictions for MJECS10?

When faced with contradictory structural predictions for MJECS10:

  • Compare prediction confidence scores across different algorithms

  • Analyze agreement between secondary structure predictions

  • Validate key structural elements experimentally (CD spectroscopy, limited proteolysis)

  • Perform consensus structural prediction using multiple tools

  • Consider temperature effects on protein folding in thermophiles

Structural predictions for thermophilic proteins can be challenging due to unique folding patterns that enhance thermostability. As noted in studies on contradictions in biomedical literature, apparent contradictions often stem from incomplete context . For MJECS10, evaluate predictions in the context of known structures from other thermophilic archaea. Consider how high temperature may impact structure – features that appear unstable at room temperature may be stabilized under M. jannaschii's native conditions (85°C). Experimental validation using methods like circular dichroism spectroscopy at elevated temperatures can help resolve contradictory predictions .

What are the most promising future research directions for understanding MJECS10 function?

The most promising research directions for MJECS10 include:

  • Integrating structural biology with functional genomics approaches

  • Developing thermophile-specific experimental systems for in vivo validation

  • Exploring potential biotechnological applications based on characterized functions

  • Investigating evolutionary conservation across extremophile archaea

  • Examining potential roles in archaeal-specific cellular processes

Future studies should leverage advances in cryo-EM and AlphaFold predictions to obtain structural insights, combined with CRISPR-based functional genomics adapted for archaeal systems. The unique properties of proteins from extremophiles like M. jannaschii often reveal novel biochemical mechanisms and potential biotechnological applications. Collaborative approaches combining computational prediction, structural analysis, and functional validation will be most effective in fully characterizing this uncharacterized protein .

How can I ensure my MJECS10 research findings are reproducible and integrate with existing knowledge?

To ensure reproducibility and integration of MJECS10 research:

  • Document complete experimental conditions, including temperature, pH, buffer composition, and cofactors

  • Deposit sequence data, structural information, and raw experimental data in public repositories

  • Standardize nomenclature and annotation across publications

  • Address potential contradictions with existing literature explicitly

  • Validate findings using multiple independent methodologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.