Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449)

Shipped with Ice Packs
In Stock

Description

Genetic Context

The MJ0449 gene is part of the M. jannaschii genome (GenBank accession: N/A), which consists of a 1.66 Mb circular chromosome and two smaller extrachromosomal elements . MJ0449 was identified through whole-genome sequencing but lacks homology to well-characterized transporters in public databases .

Key Genomic Features

  • ORF Position: Chromosomal locus (exact coordinates unspecified) .

  • Homology: No significant matches to known transporter families (e.g., ABC, MFS) .

Functional Insights

Hypothesized Roles

  • Potential involvement in metal ion transport, as inferred from its classification within CDF protein clades .

  • No direct interactions or pathway associations have been experimentally confirmed .

Research Applications

MJ0449 is commercially available for:

  • Structural Studies: Purified protein for crystallization or NMR.

  • Functional Assays: Membrane reconstitution to test transport activity.

  • Antibody Production: Immunogen due to its archaeal origin .

Handling Notes

  • Avoid repeated freeze-thaw cycles; store aliquots at -20°C/-80°C .

  • Reconstitute with glycerol (5–50%) for long-term stability .

Gaps in Knowledge

  • Substrate Specificity: No experimental evidence supports its transport capabilities .

  • Biological Role: Unclear whether MJ0449 is essential for M. jannaschii survival or metabolism .

  • Interactions: No confirmed protein-protein or protein-ligand interactions .

Future Research Directions

  • In vitro Transport Assays: Test MJ0449 in proteoliposomes with divalent cations.

  • Gene Knockout Studies: Assess phenotypic changes in M. jannaschii.

  • Structural Analysis: Resolve 3D structure to identify potential binding pockets.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag if possible.
Synonyms
MJ0449; Uncharacterized transporter MJ0449
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0449
Target Protein Sequence
MREVEKPLILSIVGNILLGLIKIIIGYVYSSISLISDGIHSLSDVITSIIGIIGVKIASK PPDESHPYGHSRFECLFSFFIGLALFFTAYEIGKFAVERIIYGEVIEVNAIMVGVAILSI VVKELMTRYSLFVGKKLNSQVLIADAYHHRSDALSSVVVLVGLLLQKFGIYYGDAIAGII VALMIAKVAFDICLTNIDYLTGRAPPKKFFELIEKEALNVDKVIGVHDIKAHYVGPRIHV ELHVEVPSNISAKEMHDIEVAVKNRLESLENVERAYVHVDIVD
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0449

STRING: 243232.MJ_0449

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0449 and what is known about its structure?

MJ0449 is an uncharacterized transporter protein encoded in the genome of the hyperthermophilic archaeon Methanocaldococcus jannaschii. It consists of 283 amino acids and is predicted to function as a membrane transporter . The protein is classified as "uncharacterized" because its precise substrate specificity, transport mechanism, and physiological role have not been fully elucidated. Based on sequence analysis and structural predictions, MJ0449 may belong to a family of membrane transporters that facilitate the movement of ions or small molecules across cellular membranes.

The protein sequence is available through the complete genome sequence of M. jannaschii, which was one of the first archaeal genomes to be fully sequenced . The genome sequencing project identified 1738 predicted protein-coding genes in M. jannaschii, including MJ0449 .

What expression systems are typically used for producing recombinant MJ0449?

Recombinant MJ0449 is typically expressed in E. coli expression systems, which have been optimized for the production of archaeal proteins . The full-length protein (amino acids 1-283) is often produced with a histidine tag to facilitate purification through affinity chromatography .

When expressing archaeal membrane proteins in mesophilic hosts like E. coli, researchers must address several challenges:

  • Codon optimization: Adjusting the coding sequence to match the codon preference of E. coli

  • Temperature considerations: Finding the optimal induction temperature that balances protein expression and proper folding

  • Membrane integration: Ensuring proper insertion into the host cell membrane

  • Toxicity management: Using tightly regulated promoters to control expression levels

For successful expression of MJ0449, researchers typically use specialized E. coli strains designed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3).

How does the extremophilic origin of M. jannaschii affect research on MJ0449?

M. jannaschii is an extremophilic archaeon that thrives in harsh environmental conditions. It grows at pressures up to more than 500 atmospheres and at temperatures ranging from 48°C to 94°C, with an optimal growth temperature near 85°C . These extreme growth conditions present both challenges and opportunities for MJ0449 research:

Challenges:

  • Difficulty in maintaining native protein conformation when expressed in mesophilic systems

  • Need for specialized equipment for functional assays at high temperatures and pressures

  • Potential instability of the protein under standard laboratory conditions

Opportunities:

  • Enhanced thermostability makes purified protein potentially more stable for structural studies

  • Unique adaptations may reveal novel mechanisms of membrane transport

  • Insights into protein evolution and adaptation to extreme environments

  • Biotechnological applications requiring thermostable proteins

When working with MJ0449, researchers must consider these extremophilic properties in experimental design, especially for functional characterization and structural studies.

What methods are most effective for purifying recombinant MJ0449?

Purification of recombinant MJ0449 requires specialized approaches due to its membrane protein nature and thermophilic origin. The most effective purification strategy typically involves:

  • Affinity Chromatography: Using His-tagged recombinant protein for initial capture on Ni-NTA or TALON resin . This step is performed after cell lysis, typically using mild detergents to solubilize the membrane-embedded protein.

  • Detergent Selection: Critical for maintaining protein stability and function during purification. Commonly used detergents include:

DetergentCMC (%)AdvantagesConsiderations
DDM (n-Dodecyl-β-D-maltoside)0.0087Mild, preserves functionLarge micelle size
LMNG (Lauryl Maltose Neopentyl Glycol)0.001Small micelles, stabilizingRelatively expensive
OG (n-Octyl-β-D-glucoside)0.53Easily removableCan be destabilizing
Digitonin0.0055Good for complex integrityNatural product, variable purity
  • Size Exclusion Chromatography: For removing aggregates and achieving high purity.

  • Thermostability Exploitation: Utilizing heat treatment steps (50-60°C) to eliminate heat-labile E. coli contaminant proteins while preserving the thermostable MJ0449.

  • Buffer Optimization: Inclusion of glycerol (10-20%) and appropriate salt concentration (typically 150-300 mM NaCl) to maintain stability during purification and storage.

The purified protein should be assessed for homogeneity using SDS-PAGE, native PAGE, and potentially analytical ultracentrifugation to ensure proper oligomeric state before functional or structural studies.

What are the challenges in determining the substrate specificity of MJ0449?

Determining the substrate specificity of an uncharacterized transporter like MJ0449 presents several methodological challenges:

  • Lack of Sequence Homology: MJ0449 may have limited sequence similarity to characterized transporters, making it difficult to predict its substrates based on homology . Phylogenetic analysis methods similar to those used for CDF (Cation Diffusion Facilitator) transporters could be applied, looking for conserved motifs or residues that might indicate substrate preference .

  • Membrane Reconstitution: Reconstituting the purified protein into liposomes or nanodiscs is essential for transport assays but technically challenging. The lipid composition must be optimized to maintain protein function, potentially using archaeal-like lipids.

  • High-Temperature Functional Assays: Given M. jannaschii's optimal growth temperature of 85°C , transport assays may need to be performed at elevated temperatures, requiring specialized equipment and thermostable fluorescent probes or radioactive substrates.

  • Unknown Physiological Context: Without knowing the metabolic pathways involving MJ0449 in M. jannaschii, researchers must test a broad range of potential substrates.

  • Limited Genetic Tools: The difficulty of genetic manipulation in M. jannaschii makes in vivo validation challenging.

Methodological approaches to overcome these challenges include:

  • Systematic substrate screening using proteoliposomes loaded with fluorescent indicators for various ions

  • Isothermal titration calorimetry to detect substrate binding

  • Thermal shift assays to identify stabilizing ligands

  • Comparative genomics to identify conserved genomic context that might suggest function

  • Heterologous expression in system like Sulfolobus acidocaldarius where genetic tools exist for archaeal membrane proteins

How can researchers assess the function of MJ0449 in heterologous systems?

Functional assessment of MJ0449 in heterologous systems requires specialized approaches to overcome the challenges of working with an archaeal membrane protein. Recommended methodologies include:

  • Complementation Studies: Using bacterial or yeast mutants deficient in specific transporters to determine if MJ0449 can rescue their phenotype. This approach has been successful with other transporters and could involve:

    • Metal-sensitive E. coli strains (if MJ0449 is suspected to be a metal transporter like CDFs)

    • Yeast mutants lacking specific nutrient transporters

    • Growth assays under various substrate conditions

  • Fluorescence-Based Transport Assays: Reconstituting purified MJ0449 into liposomes loaded with:

    • pH-sensitive fluorophores (for H+ coupled transport)

    • Ion-specific fluorescent indicators

    • Membrane potential-sensitive dyes

  • Electrophysiological Methods: Using techniques such as:

    • Solid-supported membrane electrophysiology

    • Patch-clamp of giant liposomes

    • Two-electrode voltage clamp in Xenopus oocytes (if expression is successful)

  • Radioactive Substrate Uptake: Measuring the accumulation of radiolabeled potential substrates in cells or vesicles expressing MJ0449.

  • Thermostability Considerations: All functional assays should ideally be performed at various temperatures, including elevated temperatures (50-80°C) that better reflect the native conditions of M. jannaschii .

The following table summarizes key considerations for heterologous expression systems:

Expression SystemAdvantagesLimitationsBest For
E. coliSimple genetics, high yieldMesophilic, different membrane compositionInitial expression, mutant screening
Thermophilic bacteriaGrowth at higher temperaturesDifferent transporters, metabolismTemperature-dependent studies
Yeast (S. cerevisiae)Eukaryotic processing, genetic toolsMesophilic, complex media requirementsComplementation studies
Xenopus oocytesElectrophysiology compatibleLow throughput, mesophilicDirect transport measurements
Cell-free systemsAvoid toxicity issuesLower yield, expensiveDifficult-to-express variants

How might structural studies of MJ0449 contribute to understanding archaeal membrane transporters?

Structural studies of MJ0449 would significantly advance our understanding of archaeal membrane transporters in several key ways:

  • Novel Structural Features: As an uncharacterized transporter from an archaeal hyperthermophile, MJ0449 likely possesses unique structural adaptations that contribute to its function in extreme environments. These might include:

    • Specialized transmembrane domains that maintain stability at high temperatures

    • Unusual substrate binding sites reflecting the distinct metabolic needs of M. jannaschii

    • Structural elements that confer pressure resistance

  • Evolutionary Insights: Structural comparison with bacterial and eukaryotic transporters would illuminate the evolutionary relationships between domains of life, potentially revealing:

    • Conserved transport mechanisms across all kingdoms

    • Archaeal-specific innovations in membrane protein architecture

    • Structural basis for adaptation to extreme environments

  • Methodological Approaches: Several techniques are particularly promising for studying MJ0449 structure:

    • X-ray Crystallography: The inherent stability of thermophilic proteins can facilitate crystallization. Lipidic cubic phase crystallization has been especially successful for membrane transporters.

    • Cryo-Electron Microscopy: Recent advances in single-particle cryo-EM have revolutionized membrane protein structural biology, potentially allowing structure determination without crystallization.

    • Nuclear Magnetic Resonance (NMR): For studying dynamics and substrate interactions, particularly if studying specific domains.

    • Molecular Dynamics Simulations: To understand protein behavior at high temperatures and pressures, complementing experimental structural data.

  • Functional Annotation: Structural information would facilitate the identification of key residues involved in substrate recognition and transport, potentially allowing for the functional annotation of MJ0449 and related uncharacterized transporters in archaeal genomes .

What computational methods can predict potential interaction partners of MJ0449?

Predicting potential interaction partners of MJ0449 requires sophisticated computational approaches tailored to archaeal systems. The following methodologies are particularly valuable:

  • Genomic Context Analysis: Examining the genomic neighborhood of MJ0449 in the M. jannaschii genome can provide insights into potential functional associations . This includes:

    • Identifying operons containing MJ0449

    • Analyzing gene clustering patterns across related archaeal species

    • Detecting conserved genomic proximity patterns

  • Protein-Protein Interaction (PPI) Network Prediction: Several computational tools can be adapted for archaeal systems:

    • Interolog Mapping: Transferring known interactions from homologous proteins in model organisms

    • Domain-Based Approaches: Predicting interactions based on known interacting domain pairs

    • Co-evolution Analysis: Identifying correlated mutations between MJ0449 and potential partners

  • Structural Docking Simulations: If structural models of MJ0449 can be generated through homology modeling or ab initio prediction, protein-protein docking algorithms can predict potential binding interfaces with other M. jannaschii proteins.

  • Expression Correlation Analysis: Mining transcriptomic data (if available) to identify genes with expression patterns that correlate with MJ0449, suggesting functional relationships.

  • Integrative Approaches: Combining multiple prediction methods using machine learning frameworks to improve prediction accuracy.

The table below summarizes computational tools particularly useful for archaeal protein interaction prediction:

Method CategorySpecific ToolsInput RequirementsOutput Format
Genomic ContextSTRING, GeConT, FgenesBGenome sequence, gene coordinatesFunctional association scores
Structural PredictionAlphaFold, RoseTTAFoldProtein sequence3D structural models
Protein DockingHADDOCK, ClusPro, ZDOCKProtein structuresInteraction models, binding energies
Network AnalysisArchaeal-specific PPI databasesProtein identifiersInteraction networks, confidence scores
Sequence-BasedPIPE, SPRINTProtein sequencesPredicted interactions, binding sites

For MJ0449, these computational predictions should be treated as hypotheses to guide experimental validation using techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling approaches.

What role might MJ0449 play in the adaptation of M. jannaschii to extreme environments?

Understanding the role of MJ0449 in the adaptation of M. jannaschii to extreme environments requires consideration of the organism's unique ecological niche and physiological requirements. M. jannaschii is a hyperthermophilic archaeon that grows at pressures of up to more than 500 atmospheres and temperatures ranging from 48-94°C, with an optimum near 85°C . It was isolated from deep-sea hydrothermal vents, specifically a "white smoker" chimney at 2600m depth .

Potential adaptive roles of MJ0449 may include:

  • Ion Homeostasis Under Extreme Conditions: As a membrane transporter, MJ0449 may be critical for maintaining appropriate intracellular concentrations of specific ions or molecules under high temperature and pressure conditions. The protein may function similarly to Cation Diffusion Facilitator (CDF) transporters, which are known to transport metal ions and play roles in metal homeostasis .

  • Thermostability Mechanisms: Analysis of MJ0449's sequence and predicted structure might reveal specific adaptations that contribute to protein stability at high temperatures:

    • Increased proportion of charged residues forming salt bridges

    • Higher hydrophobicity in the protein core

    • Shorter surface loops vulnerable to thermal denaturation

    • Strategic positioning of proline residues to reduce conformational flexibility

  • Pressure Adaptation: Features that might contribute to barotolerance include:

    • Specific membrane-protein interfaces that maintain functionality under pressure

    • Conformational flexibility allowing transport function despite compression

    • Structural elements that resist pressure-induced denaturation

  • Metabolic Integration: As M. jannaschii is autotrophic and produces methane , MJ0449 might transport substrates essential for:

    • Energy generation pathways unique to methanogens

    • Carbon fixation under anaerobic conditions

    • Nutrient acquisition in the nutrient-limited deep-sea environment

  • Stress Response: The transporter may play a role in cellular responses to fluctuations in environmental conditions at hydrothermal vents:

    • Export of toxic compounds that accumulate under stress

    • Import of protective osmolytes or precursors

    • Maintenance of membrane potential under variable conditions

Experimental approaches to investigate these hypotheses could include:

  • Comparative expression analysis under different temperature and pressure conditions

  • Creation of conditional knockdown strains (if genetic tools become available)

  • Reconstitution in liposomes with varying lipid compositions reflecting different thermal adaptations

  • Transport assays under varying temperature and pressure conditions

How should researchers design site-directed mutagenesis studies for MJ0449?

Designing effective site-directed mutagenesis studies for MJ0449 requires careful selection of target residues and appropriate experimental controls. Here's a methodological framework:

  • Target Residue Selection: Prioritize residues based on:

    • Conserved motifs identified through multiple sequence alignments with related transporters

    • Predicted functional domains (substrate binding, transport pathway, oligomerization interfaces)

    • Residues analogous to those proven important in related transporters, such as the group-conserved residue D (for Mn-specific CDF transporters) or H (for Zn- and Fe/Zn-CDF transporters) embedded in transmembrane domain V

    • Unique residues that may contribute to extremophilic adaptation

  • Mutation Design Strategy:

Mutation TypePurposeExample
Conservative substitutionsTest importance of chemical propertiesD→E, K→R, I→L
Non-conservative substitutionsDisrupt function completelyD→A, K→A, H→A
Cysteine substitutionsEnable subsequent chemical labelingX→C
Proline substitutionsDisrupt helical structuresX→P
Charge reversalsTest electrostatic interactionsD→K, K→E
Thermostability mutationsEnhance protein stabilityBased on consensus design
  • Experimental Controls:

    • Wild-type MJ0449 (positive control)

    • Empty vector (negative control)

    • Well-characterized mutations in related transporters as reference points

    • Multiple substitutions at each position (alanine, conservative, non-conservative)

  • Functional Assays: Evaluate mutants using:

    • Transport assays in proteoliposomes or whole cells

    • Thermal stability measurements to detect structural perturbations

    • Substrate binding assays

    • Subcellular localization to confirm proper membrane integration

  • Data Analysis Framework:

    • Quantitative comparison to wild-type activity levels

    • Temperature-dependent activity profiles

    • Kinetic parameters (Km, Vmax) for substrate transport

    • Integration of results with structural models

This approach has been successfully applied to other transporters, as demonstrated by studies on RmCzcD, EcZitB, EcFieF, and PtdMTP1 , where specific residues were identified as critical for function through systematic mutagenesis.

How might synthetic biology approaches enhance our understanding of MJ0449 function?

Synthetic biology offers innovative approaches to studying MJ0449 by enabling the creation of artificial systems that can reveal functional insights not accessible through traditional methods. Key synthetic biology strategies include:

  • Minimal Transporter Design:

    • Engineering minimal versions of MJ0449 that retain core functionality

    • Determining the essential structural elements through systematic domain truncation

    • Creating chimeric transporters by combining domains from MJ0449 with well-characterized transporters to assess domain functions

  • Biosensor Development:

    • Converting MJ0449 into a biosensor by coupling transport activity to fluorescent or luminescent outputs

    • Engineering allosteric binding sites that trigger conformational changes detectable via FRET

    • Developing whole-cell biosensors where MJ0449 transport activity is linked to reporter gene expression

  • Orthogonal Expression Systems:

    • Creating specialized expression chassis optimized for archaeal membrane proteins

    • Developing cell-free expression systems incorporating archaeal lipids and chaperones

    • Engineering synthetic vesicles with defined lipid compositions to study transporter function

  • Rational Protein Engineering:

    • Enhancing thermostability through consensus design approaches

    • Modifying substrate specificity through targeted mutagenesis

    • Engineering regulatory domains to control transport activity

  • High-Throughput Functional Characterization:

    • Developing microfluidic platforms for rapid screening of transporter variants

    • Creating deep mutational scanning libraries to comprehensively map sequence-function relationships

    • Implementing directed evolution schemes to identify variants with enhanced or altered functions

The following table outlines experimental design considerations for synthetic biology approaches:

ApproachKey ComponentsExpected OutcomesTechnical Challenges
Domain swappingTransmembrane domains, substrate binding sitesIdentification of functional modulesMaintaining proper membrane insertion
Directed evolutionMutagenesis libraries, selection systemsVariants with altered propertiesDeveloping appropriate selection pressure
Reconstitution systemsArtificial membranes, purified componentsMinimal functional unitsStability of synthetic membranes
Protein switchesSensing domains, actuator domainsControllable transport activityEngineering allosteric communication
Synthetic circuitsGenetic regulators, metabolic pathwaysSystems-level understandingBalancing expression levels

These synthetic biology approaches would complement traditional biochemical and structural studies, potentially revealing emergent properties and functional principles not evident from studying the native protein alone.

What challenges exist in structural determination of MJ0449 and how might they be overcome?

Structural determination of membrane proteins like MJ0449 presents significant challenges, though the thermostable nature of this archaeal protein offers some advantages. Here's a comprehensive analysis of challenges and potential solutions:

  • Protein Expression and Purification Challenges:

    • Challenge: Obtaining sufficient quantities of properly folded protein

    • Solutions:

      • Utilize specialized expression systems for membrane proteins (e.g., C41/C43 E. coli strains)

      • Explore fusion partners that enhance expression (e.g., GFP, MBP)

      • Implement high-throughput screening of expression conditions

      • Consider cell-free expression systems

  • Membrane Extraction and Stability:

    • Challenge: Maintaining native conformation during extraction from membranes

    • Solutions:

      • Screen multiple detergents and nanodiscs systematically

      • Utilize lipid-like peptides or styrene maleic acid copolymers for native extraction

      • Exploit the inherent thermostability of MJ0449 with heat purification steps

      • Employ thermostable detergents designed for extremophile proteins

  • Crystallization Barriers for X-ray Crystallography:

    • Challenge: Obtaining well-diffracting crystals of membrane proteins

    • Solutions:

      • Lipidic cubic phase crystallization

      • Surface engineering to create crystal contacts

      • Antibody fragment co-crystallization

      • Fusion with crystallization chaperones

  • Cryo-EM Specific Challenges:

    • Challenge: Small size of MJ0449 (283 amino acids) may be below optimal size for cryo-EM

    • Solutions:

      • Complex with antibody fragments to increase molecular weight

      • Utilize latest generation direct electron detectors

      • Apply novel computational approaches for small protein reconstruction

      • Consider Volta phase plates to enhance contrast

  • NMR Spectroscopy Considerations:

    • Challenge: Size limitations and spectral complexity

    • Solutions:

      • Focus on specific domains rather than the entire protein

      • Utilize solid-state NMR approaches

      • Selective isotopic labeling to reduce spectral complexity

  • Method-Specific Optimization Strategies:

MethodKey Optimization ApproachesBenefits for MJ0449
X-ray CrystallographyThermostability assays to identify stabilizing conditionsExploits natural thermostability of archaeal proteins
Cryo-EMNew processing algorithms for small membrane proteinsAvoids crystallization bottleneck
NMR SpectroscopyDeuteration strategies to improve spectral qualityProvides dynamic information
Integrative ModelingCombines low-resolution data with computational predictionLeverages multiple experimental inputs
AlphaFold2 and related toolsDeep learning structure prediction with experimental constraintsProvides starting models for refinement
  • Leveraging Archaeal Characteristics:

    • The extremophilic nature of M. jannaschii proteins can be advantageous, as thermostable proteins often demonstrate enhanced conformational stability during purification and structure determination

    • Potential for structural studies at elevated temperatures to capture physiologically relevant conformations

    • Use of archaeal lipids or lipid mimetics to maintain native-like environment

Successful structural determination will likely require an integrative approach combining multiple methods and extensive optimization of conditions specifically tailored to the unique properties of this archaeal membrane protein.

How does research on MJ0449 contribute to our broader understanding of archaeal biology?

Research on the uncharacterized transporter MJ0449 from Methanocaldococcus jannaschii contributes significantly to our broader understanding of archaeal biology in several key ways:

  • Evolutionary Insights: As one of the 1738 predicted protein-coding genes identified in the M. jannaschii genome , characterizing MJ0449 helps fill critical gaps in our understanding of archaeal evolution and adaptation. The protein may represent unique archaeal innovations or conserved features shared across domains of life, providing evidence for evolutionary relationships between archaea, bacteria, and eukaryotes.

  • Extremophile Adaptation Mechanisms: M. jannaschii thrives in extreme conditions (high temperature, high pressure, strict anaerobiosis) , and MJ0449 likely contributes to this remarkable adaptability. Understanding its structure and function provides insights into molecular adaptation strategies that enable life in extreme environments, potentially revealing novel mechanisms for membrane transport under challenging conditions.

  • Archaeal Membrane Biology: The archaeal cell membrane contains unique lipids with ether linkages rather than the ester linkages found in bacteria and eukaryotes. Characterizing membrane transporters like MJ0449 advances our understanding of how proteins function within these distinctive membrane environments and how archaeal membrane biology differs from other domains of life.

  • Metabolic Networks in Methanogens: As an autotrophic archaeon that produces methane , M. jannaschii possesses specialized metabolic pathways. Elucidating the role of MJ0449 could reveal how transport processes integrate with these unique metabolic networks, particularly if the protein transports substrates or cofactors essential for methanogenesis or carbon fixation.

  • Biotechnological Applications: The thermostable nature of MJ0449 makes it potentially valuable for biotechnological applications requiring robust proteins. Insights gained from studying this protein could inform the design of stable transporters for bioremediation, biosensors, or industrial processes operating under harsh conditions.

  • Methodological Advances: Research on challenging proteins like MJ0449 drives the development of new experimental and computational approaches for studying membrane proteins from non-model organisms, benefiting the broader field of structural and functional proteomics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.