Recombinant Methanocaldococcus jannaschii UPF0014 membrane protein MJ0938 (MJ0938)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Research Gaps

MJ0938 belongs to the UPF0014 family, a group of uncharacterized proteins with putative roles in membrane processes. While no direct experimental data on MJ0938’s function exists, its classification as a membrane protein suggests involvement in:

  • Membrane structural integrity

  • Signal transduction

  • Transport or sensory functions

Applications and Future Directions

MJ0938’s recombinant availability enables experimental studies to elucidate its role. Potential research avenues include:

  1. Membrane localization studies using fluorescence microscopy or protease protection assays.

  2. Interaction mapping to identify binding partners (e.g., other membrane proteins or cofactors).

  3. Structural characterization via cryo-EM or X-ray crystallography to resolve conformational dynamics.

Comparative Analysis with Related Proteins

While MJ0938 lacks direct homologs in model organisms, its UPF0014 classification aligns with other archaeal membrane proteins of unknown function. For example, the MJ1443 protein (UPF0132 family) is similarly annotated as a membrane protein but lacks functional data . This underscores the broader challenge in characterizing archaeal membrane proteins, which often require specialized experimental approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are happy to accommodate your specific format requirements. Please indicate your preferences in the order notes section, and we will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development with your specified tag.
Synonyms
MJ0938; UPF0014 membrane protein MJ0938
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0938
Target Protein Sequence
MIIKVMVMLLIELTYAFIFVIIAVLIAYREKLGIEKKILYVSILALIQLFILGFVLLYIF SFGMVGAFLMIGVMITLASYLIMREINLKNKTKLFICLFITFLTTTIVSLAVLTIPKVVK FEPIYVIPLMGMVIGNTMNTIHLALDKIIDMVKSERDILWGYLALGATEIEALRPFIKNA VKSAVIPQMNRTKSVGVIFIPGAMVGMLLSGANPIYAAEIQIIIMWMILSSAVISGILIC YLMYKEIIRA
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0938

STRING: 243232.MJ_0938

Protein Families
UPF0014 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for membrane protein research?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon that grows optimally at 80°C. It represents one of the phylogenetically deeply rooted methanogens and serves as an important model organism for studying archaeal biology and extremophilic adaptations. The significance of M. jannaschii in membrane protein research stems from its unique adaptations to extreme environments, which include specialized membrane proteins capable of functioning at high temperatures. These proteins often possess extraordinary stability, making them valuable models for structural and functional studies. Additionally, M. jannaschii was the first archaeon to have its genome completely sequenced, providing substantial genomic data for comparative analysis of membrane proteins across domains of life .

What are the optimal growth conditions for culturing M. jannaschii?

M. jannaschii requires specific growth conditions that mimic its natural deep-sea hydrothermal vent environment:

  • Temperature: 80°C (optimal)

  • Growth medium: Specialized anaerobic medium (Medium 1)

  • Gas atmosphere: H₂ and CO₂ mixture (80:20, v/v) at 3 × 10⁵ Pa

  • Incubation: Shaker incubator at 200 rpm

  • Culture vessels: Sealed serum bottles (160 or 530 ml) containing 10 or 200 ml of medium

For liquid cultures, the sealed bottles are pressurized with the H₂/CO₂ mixture and incubated in a shaker. M. jannaschii grows rapidly under optimal conditions with a doubling time of approximately 26 minutes, which is significantly faster than other methanogenic archaea such as Methanobrevibacter maripaludis (2 hours) and Methanosarcina acetivorans (8.5 hours) .

What challenges are associated with expressing recombinant archaeal membrane proteins?

Recombinant expression of archaeal membrane proteins presents several distinct challenges:

  • Hydrophobicity issues: Membrane proteins contain extensive hydrophobic surfaces that can cause aggregation during expression and purification.

  • Folding complexity: Ensuring proper folding in heterologous expression systems is difficult, as membrane insertion machinery may differ between archaea and expression hosts.

  • Post-translational modifications: Archaeal-specific modifications may be absent in bacterial or eukaryotic expression systems.

  • Thermostability considerations: For hyperthermophiles like M. jannaschii, proteins are evolved to function optimally at high temperatures (80°C), while most expression systems operate at lower temperatures.

  • Detergent compatibility: Identifying appropriate detergents for extraction and purification that maintain protein structure and function remains challenging.

These challenges often necessitate specialized approaches, including homologous expression systems where the protein is expressed within M. jannaschii itself, as demonstrated successfully with other M. jannaschii proteins like FprA .

How can researchers verify the identity and purity of recombinant MJ0938?

Verification of recombinant MJ0938 identity and purity typically involves multiple complementary techniques:

  • SDS-PAGE analysis: For assessing protein homogeneity and approximate molecular weight

  • Western blot analysis: Using tag-specific antibodies if the recombinant protein carries affinity tags

  • Mass spectrometry: For peptide identification and sequence coverage verification

  • N-terminal sequencing: To confirm the correct start of the protein

  • Size exclusion chromatography: To assess oligomeric state and homogeneity

For example, with the M. jannaschii FprA protein, researchers used SDS-PAGE to demonstrate homogeneity, Western blot with anti-FLAG antibodies to confirm tag presence, and mass spectrometric analysis of thermolysin digests to identify peptides covering 55% of the protein's primary structure, including affinity tags .

What genetic systems are available for expressing and studying MJ0938 in M. jannaschii?

Recent advances have established genetic manipulation systems for M. jannaschii that can be applied to study MJ0938. These systems offer advantages over heterologous expression:

Homologous expression system features:

  • Utilizes suicide plasmids for genome integration through double crossover homologous recombination

  • Employs mevinolin resistance as a selectable marker

  • Allows addition of affinity tags (e.g., 3xFLAG-twin Strep tag) for purification

  • Enables placement of genes under control of engineered promoters

  • Achieves colony formation on solid medium in 3-4 days

This system has been successfully used for homologous overexpression of proteins with affinity tags in M. jannaschii, as demonstrated with FprA (MJ0748). The approach is simpler and less time-consuming than methods used for other methanogens, avoiding the need for chemical treatments with polyethylene glycol or liposomes .

Transformation protocol overview:

  • Linearize suicide vector containing homologous regions flanking the target gene

  • Transform M. jannaschii using heat shock

  • Select transformants on solid medium with mevinolin

  • Verify recombination by PCR analysis of chromosomal DNA

This genetic system could be adapted for studying MJ0938 through:

  • Gene deletion or modification

  • Addition of affinity tags for purification

  • Promoter engineering for controlled expression

  • Point mutations for structure-function analysis

What innovative approaches can be used to solubilize MJ0938 while preserving its structure and function?

Recent advances in membrane protein solubilization have produced promising alternatives to conventional detergent-based methods:

Water-soluble RFdiffused Amphipathic Proteins (WRAPs):
A deep learning-based design approach has been developed for solubilizing membrane proteins while preserving their native sequence, fold, and function. This method employs genetically encoded de novo proteins called WRAPs that surround the lipid-interacting hydrophobic surfaces of membrane proteins, rendering them stable and water-soluble without detergents .

The WRAP approach has successfully solubilized both β-barrel outer membrane and helical multi-pass transmembrane proteins, with several advantages:

  • Preservation of protein binding and enzymatic functions

  • Enhanced stability compared to detergent-solubilized proteins

  • Facilitation of structural characterization (demonstrated by 4.0 Å cryo-EM mapping)

  • Potential for generating intact immunogens for vaccine development

This technology could be particularly valuable for MJ0938, as it may maintain the protein's native conformation and thermostability properties while providing a water-soluble form suitable for biochemical and structural studies .

How can researchers optimize purification strategies for recombinant MJ0938?

Purification of recombinant archaeal membrane proteins requires specialized strategies to maintain protein stability and function:

Affinity tag-based purification workflow:

  • Expression with appropriate tags:

    • Twin Strep tag and FLAG tag combinations have proven effective for archaeal proteins

    • Tag placement (N or C-terminal) should be optimized based on predicted topology

  • Cell lysis considerations:

    • Mechanical disruption methods (e.g., French press) for hyperthermophiles

    • Buffer composition including stabilizing agents (glycerol, specific ions)

    • Temperature control during processing

  • Affinity chromatography:

    • Streptactin XT superflow columns allow efficient capture

    • Elution with biotin (10 mM D-biotin has been effective)

    • Temperature-controlled chromatography may preserve native conformation

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

A comparable approach with M. jannaschii FprA yielded 0.26 mg of purified protein per liter of culture, with excellent homogeneity as confirmed by SDS-PAGE analysis .

Purification StepBuffer CompositionTemperatureYield (mg/L culture)Purity
Crude ExtractExtraction buffer with stabilizers4°C~2-5<20%
Streptactin XTBinding buffer with detergent4-25°C~0.2-0.5>90%
Size ExclusionRunning buffer, reduced detergent4-25°C~0.1-0.3>95%

What structural characterization methods are most suitable for MJ0938?

Multiple complementary approaches can be employed for structural characterization of MJ0938:

Cryo-electron microscopy (cryo-EM):

  • Particularly suitable for membrane proteins solubilized with WRAPs

  • Can achieve moderate resolution (e.g., 4.0 Å) for structural model validation

  • Does not require crystallization

  • Compatible with various detergent and non-detergent solubilization methods

X-ray crystallography:

  • Requires successful crystallization of the membrane protein

  • Can potentially provide high-resolution structures

  • Challenges include obtaining diffraction-quality crystals

Nuclear Magnetic Resonance (NMR):

  • Useful for dynamics studies and investigating protein-ligand interactions

  • May require isotopic labeling of the protein

  • Size limitations may be overcome using selective labeling strategies

Computational approaches:

  • Modern deep learning-based structure prediction tools like AlphaFold

  • Molecular dynamics simulations to model behavior in membrane environments

  • Homology modeling based on related proteins with known structures

For initial characterization, a combination of cryo-EM with WRAP solubilization and computational modeling may offer the most efficient path to structural insights for MJ0938.

How can researchers investigate the physiological function of MJ0938 in M. jannaschii?

Investigating the physiological function of MJ0938 requires multiple approaches:

Genetic manipulation strategies:

  • Generation of knockout mutants using the established genetic system

  • Construction of conditional expression strains

  • Creation of point mutations to target specific domains or residues

  • Phenotypic characterization under various growth conditions

Biochemical function assays:

  • Activity testing with predicted substrates

  • Protein-protein interaction studies

  • Subcellular localization analysis

Comparative genomics and transcriptomics:

  • Analysis of gene neighborhood and conserved genomic context

  • Transcriptional response to environmental stressors

  • Co-expression analysis with functionally related genes

The genetic system developed for M. jannaschii provides the necessary tools for these in vivo analyses. Unlike previous systems for other methanogens, this approach is simpler and less time-consuming, with transformation requiring only heat shock rather than chemical treatments with polyethylene glycol or liposomes .

What are the challenges in crystallizing MJ0938 for structural studies?

Crystallization of membrane proteins like MJ0938 presents unique challenges:

Common obstacles:

  • Detergent micelles can interfere with crystal contacts

  • Conformational heterogeneity reduces crystallization propensity

  • Limited polar surfaces for crystal contact formation

  • Instability outside the native membrane environment

Innovative solutions:

  • Crystallization in lipidic cubic phases or bicelles

  • Use of antibody fragments or nanobodies to increase polar surface area

  • Thermostabilizing mutations to reduce conformational flexibility

  • WRAP technology to provide a detergent-free, water-soluble form amenable to crystallization

  • Fusion partners that promote crystallization (e.g., T4 lysozyme, BRIL)

The high thermostability of M. jannaschii proteins provides a potential advantage for crystallization, as thermal stability often correlates with conformational stability, which can improve crystallization outcomes.

How can researchers address problems with recombinant MJ0938 expression levels?

Low expression levels are a common challenge with archaeal membrane proteins:

Expression optimization strategies:

  • Promoter engineering:

    • Use of strong, controlled promoters like the engineered P* promoter

    • Development of inducible expression systems

  • Codon optimization:

    • Adaptation of codons to the expression host

    • Analysis of rare codons and GC content

  • Expression host selection:

    • Homologous expression in M. jannaschii

    • Specialized heterologous hosts for challenging proteins

  • Fusion partners:

    • Addition of solubility-enhancing tags

    • Use of well-expressed proteins as fusion partners

  • Culture conditions optimization:

    • Temperature modulation

    • Media composition adjustments

    • Induction timing and duration

Homologous expression in M. jannaschii, as demonstrated with FprA, represents a promising approach for MJ0938. This system has shown the capacity to produce moderate yields of properly folded, active protein with attached affinity tags .

What bioinformatic tools can predict potential functions of UPF0014 family proteins like MJ0938?

Modern bioinformatic approaches provide valuable insights into poorly characterized proteins:

Sequence-based tools:

  • Multiple sequence alignment with UPF0014 family members

  • Motif identification through PROSITE, PFAM databases

  • Transmembrane topology prediction (TMHMM, Phobius)

  • Signal peptide analysis (SignalP)

Structure-based approaches:

  • AlphaFold2 for accurate structure prediction

  • Structural comparison with characterized proteins (DALI server)

  • Active site prediction and conservation analysis

  • Molecular docking for potential ligand identification

Genomic context analysis:

  • Gene neighborhood conservation

  • Co-occurrence patterns across species

  • Genomic island identification

  • Evolutionary rate analysis

Transcriptomic/proteomic data integration:

  • Expression pattern analysis

  • Co-expression networks

  • Condition-specific regulation

By integrating these computational approaches with targeted experimental validation, researchers can develop testable hypotheses about MJ0938 function that guide efficient experimental design.

How can isotopic labeling of MJ0938 be achieved for NMR studies?

Isotopic labeling of archaeal membrane proteins presents unique challenges that require specialized approaches:

Homologous expression labeling strategy:

  • Labeled media development:

    • Design of defined minimal media containing ¹⁵N-ammonium salts and/or ¹³C-methanol/¹³C-acetate

    • Supplementation with appropriate growth factors and minerals

  • Growth optimization:

    • Adaptation of M. jannaschii to labeled media

    • Scale-up considerations for sufficient protein yield

  • Purification considerations:

    • Affinity chromatography using engineered tags

    • Specialized NMR-compatible detergents or nanodiscs

Heterologous expression alternative:

  • Expression in E. coli grown on isotopically labeled media

  • Cell-free protein synthesis with labeled amino acids

  • Selective labeling of specific amino acids for targeted analysis

The established genetic system for M. jannaschii could be adapted to incorporate appropriate affinity tags into MJ0938, facilitating purification of the labeled protein for subsequent NMR studies .

What are the most effective methods for studying MJ0938 interactions with other proteins?

Understanding protein-protein interactions involving membrane proteins requires specialized approaches:

In vivo interaction methods:

  • Split-protein complementation assays adapted for thermophiles

  • Protein complex immunoprecipitation using tagged MJ0938

  • Crosslinking followed by mass spectrometry (XL-MS)

  • FRET-based interaction assays with fluorescent protein variants

In vitro interaction methods:

  • Surface plasmon resonance with immobilized MJ0938

  • Microscale thermophoresis for quantitative binding analysis

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Pull-down assays using affinity-tagged MJ0938

Computational prediction:

  • Protein-protein docking simulations

  • Coevolution analysis to identify interacting interfaces

  • Network analysis of genomically or functionally related proteins

The genetic system demonstrated for M. jannaschii allows for the creation of affinity-tagged versions of MJ0938, facilitating pull-down experiments to identify interacting partners in their native cellular context .

How can researchers develop a markerless genetic system for studying MJ0938 function?

Development of a markerless genetic system would enhance the study of MJ0938:

Potential markerless approaches for M. jannaschii:

  • Merodiploid segregation method:

    • Integration of a suicide vector with selectable marker

    • Allow segregation to mutant and wild-type forms

    • Screen for desired genotype without permanent marker

  • FLP recombinase system:

    • Employ hyperthermophilic FLP recombinase (e.g., from Sulfolobus shibatae)

    • Design constructs with FLP recognition target (FRT) sites

    • Remove selectable marker through FLP-mediated recombination

  • Counter-selection systems:

    • Develop negative selection markers for M. jannaschii

    • Utilize genes that convert non-toxic compounds to toxic products

    • Select for loss of marker during second recombination event

These markerless approaches would be particularly valuable for constructing multiple modifications or studying potentially essential genes like MJ0938. The development of such systems would represent a significant advancement for functional genomics in M. jannaschii .

How does MJ0938 compare to homologous proteins in other archaea and bacteria?

Comparative analysis provides evolutionary context for understanding MJ0938:

Cross-domain comparison factors:

  • Sequence conservation patterns

  • Structural similarities and differences

  • Genomic context conservation

  • Functional annotations of homologs

Evolutionary analyses:

  • Phylogenetic distribution of UPF0014 family proteins

  • Identification of conserved residues suggesting functional importance

  • Analysis of selection pressure on different protein domains

  • Horizontal gene transfer events in the evolutionary history

The hyperthermophilic nature of M. jannaschii likely influences the properties of MJ0938 compared to mesophilic homologs, with adaptations that might include increased hydrophobic interactions, additional salt bridges, and optimized surface charge distribution for function at high temperatures.

What can functional genomics approaches reveal about MJ0938's role?

Functional genomics provides system-level insights into MJ0938 function:

Multi-omics integration strategies:

  • Transcriptomic profiling under various stress conditions

  • Proteomic analysis of membrane fractions

  • Metabolomic changes in knockout or overexpression strains

  • Genome-wide interaction screens

Data integration approaches:

  • Correlation networks linking MJ0938 to other cellular processes

  • Pathway enrichment analysis

  • Machine learning for function prediction based on multiple data types

The genetic manipulation system established for M. jannaschii enables the creation of knockout, knockdown, or overexpression strains necessary for these functional genomics approaches. The system's relative simplicity compared to other methanogen genetic systems makes these studies more accessible .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.