Recombinant Methanocaldococcus jannaschii UPF0056 membrane protein MJ0972 (MJ0972)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Characteristics

MJ0972 is expressed in Escherichia coli as a recombinant protein with an N-terminal His tag (6xHis) to facilitate purification. Its full-length sequence spans 228 amino acids (1–228) and includes a predicted transmembrane topology. Key specifications include:

ParameterValue
Source OrganismMethanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661)
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 50% glycerol recommended

The protein is lyophilized and stored at -20°C or -80°C, with aliquoting advised to avoid freeze-thaw cycles .

Functional and Pathway Implications

While MJ0972’s exact biological role remains uncharacterized, its classification as a UPF0056 protein and membrane localization suggest potential involvement in:

  • Membrane Transport: Facilitating ion or metabolite exchange in M. jannaschii, which thrives in high-temperature environments .

  • Cofactor Biosynthesis: Methanogens rely on unique cofactors (e.g., F420, methanopterin), and MJ0972 may assist in their synthesis or regulation .

  • Stress Adaptation: Membrane proteins in thermophiles often mediate responses to thermal or osmotic stress .

No direct pathway associations are documented, but its presence in M. jannaschii’s genome highlights its niche-specific importance .

Research Applications

MJ0972 is utilized in diverse experimental contexts:

Diagnostic and Assay Development

  • ELISA Kits: Recombinant MJ0972 is used as an antigen in enzyme-linked immunosorbent assays (ELISA) for detecting antibodies or binding partners .

Comparative Proteomics

  • Archaeal Membrane Biology: MJ0972 serves as a model for studying membrane protein evolution and function in extremophiles .

Table 2: AlphaFold Confidence Scores

RegionpLDDT RangeConfidence Level
N-terminal (1–50)75–85Moderate to High
Mid (51–150)80–90High
C-terminal (151–228)70–80Confident

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MJ0972; UPF0056 membrane protein MJ0972
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0972
Target Protein Sequence
MVGYSGEHFIFNVVKYMDILNFYIYGFVSLFITIDPIGLIPIVHSLTYPYPKEQRIRIIK KAIISSTVVLLLFALFGNYIFGYFGITIDAFRVAGGILLFKIAWDMLHAEIPKTKHKPDE RLDLEDIDSIVYVPLAIPLISGPGAITTTMILISKTQSILEKGVVVLSILSAMLVSGIIL SLTDFIIRRVNIYGINAFVRIMGLLLVAISVQIIFTGIVGLYNSISVQ
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0972

STRING: 243232.MJ_0972

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for protein research?

Methanocaldococcus jannaschii is a hyperthermophilic methanogen isolated from a deep-sea hydrothermal vent where environmental conditions mimic those of early Earth . It derives energy solely from hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O), one of the most ancient respiratory metabolisms on Earth, developed approximately 3.49 billion years ago . It generates its entire cellular material from inorganic nutrients, representing minimal requirements for life to exist independently of other living systems .

Significantly, M. jannaschii was the first archaeon and third organism for which the whole genome sequence was determined . This sequencing milestone revealed many novel metabolic features and provided genomic basis for known special features of archaea . The unique proteins from this extremophile, including membrane proteins like MJ0972, often exhibit exceptional stability, making them valuable subjects for structural and functional studies.

What are the genomic features of M. jannaschii and how is MJ0972 annotated in the genome?

M. jannaschii has a large circular chromosome that is 1.66 mega base pairs long with a G+C content of 31.4% . The species also possesses a large circular extra-chromosome and a small circular extra-chromosome . When the genome was first sequenced, approximately 60% of the genes had no predicted function assigned . The MJ0972 gene is annotated as encoding a UPF0056 family membrane protein, with UPF indicating an "Uncharacterized Protein Family."

What are the optimal growth conditions for M. jannaschii, and how do they impact the native expression of membrane proteins?

M. jannaschii requires strictly anaerobic conditions and grows optimally at 80°C with a mixture of H₂ and CO₂ (80:20, v/v) as methanogenesis substrates . For cultivation in liquid medium, sealed serum bottles containing anaerobic and sterile medium are pressurized with this gas mixture to 3 × 10⁵ Pa . The organism grows rapidly with a doubling time of approximately 26 minutes .

These extreme growth conditions (high temperature, strictly anaerobic environment) reflect the native environment in which membrane proteins like MJ0972 function. Membrane proteins expressed by M. jannaschii are adapted to function optimally under these conditions, particularly within highly rigid archaeal lipid membranes that maintain fluidity at high temperatures.

What are the most effective heterologous expression systems for producing recombinant MJ0972?

For recombinant expression of archaeal membrane proteins like MJ0972, several systems can be considered with varying advantages:

Expression SystemAdvantagesChallengesRecommended Modifications
E. coliHigh yield, rapid growth, well-established protocolsPotential misfolding at mesophilic temperatures, toxic effectsCodon optimization, fusion tags (SUMO, MBP), specialized strains (C41/C43)
Haloferax volcaniiArchaeal host, similar membrane environmentLower yield, specialized media requirementsOptimize promoter strength, include native signal sequences
Saccharomyces cerevisiaeEukaryotic machinery, good for complex MPsGlycosylation differences, lower temperatureOptimize codons, use strong inducible promoters
Homologous expression in M. jannaschiiNative folding environmentTechnically challenging cultivation, lower yieldUse genetic system with Psla-hmgA selectable marker

For most research applications, E. coli-based expression with specialized modifications offers the best compromise between yield and proper folding.

How can I enhance the stability and folding of recombinant MJ0972 during heterologous expression?

Based on approaches used for other hyperthermophilic membrane proteins:

  • Temperature optimization: Express at elevated temperatures (37-45°C) to promote proper folding while not causing excessive stress to the host

  • Chaperone co-expression: Co-express molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE to facilitate folding

  • Fusion partners: Use solubility-enhancing fusion partners like MBP or thermostable domains

  • Detergent screening: Identify detergents that stabilize the protein during extraction and purification

  • Lipid supplementation: Add archaeal lipids or synthetic lipid analogs to mimic the native membrane environment

Incorporating these strategies can significantly improve the yield of correctly folded MJ0972.

What genetic manipulation techniques are available for expressing modified versions of MJ0972 in M. jannaschii?

Recent advances have established genetic tools for M. jannaschii that enable homologous expression of proteins with affinity tags. A genetic system has been developed using mevinolin resistance (via the Psla-hmgA cassette) as a selectable marker . The transformation protocol involves:

  • Growing M. jannaschii cells at 65°C to mid-log phase (OD₆₀₀ = 0.5-0.7)

  • Harvesting cells anaerobically and resuspending in pre-reduced medium

  • Incubating cells at 4°C for 30 minutes

  • Adding linearized suicide vector DNA (2 μg)

  • Further incubation at 4°C for one hour

  • Heat-shocking at 85°C for 45 seconds

  • Recovery at 4°C for 10 minutes

  • Outgrowth in medium supplemented with yeast extract

  • Selection on solid medium containing mevinolin

This approach has been successfully used to create strains overexpressing tagged proteins through double homologous recombination events , and could be adapted for MJ0972 expression studies.

What are the most effective detergents for solubilizing and purifying MJ0972?

While specific data for MJ0972 is limited, a methodological screening approach should include:

Detergent ClassExamplesAdvantages for Hyperthermophilic MPsRecommended Concentration
Maltoside-basedDDM, DM, UDMMild extraction, maintain stability1-2% for solubilization, 2-3× CMC for purification
Glucoside-basedOG, NGEffective for compact MPs1.5-2.5% for solubilization
Neopentyl glycolLMNG, DMNGEnhanced stability for MPs0.5-1% for solubilization
Peptide-basedSMA, amphipolsNative-like environmentAccording to manufacturer
Cholate derivativesSodium cholateCompatible with crystallization0.5-1.5%

Thermostability assays should be performed with each detergent at varying temperatures (40-90°C) to identify conditions that preserve the native structure of MJ0972.

What crystallization approaches have been most successful for membrane proteins from hyperthermophilic archaea?

For membrane proteins from hyperthermophilic archaea, consider these specialized crystallization approaches:

  • Lipidic cubic phase (LCP): Provides a membrane-mimetic environment that can stabilize the protein in a native-like conformation

  • Bicelle crystallization: Uses discoidal lipid-detergent assemblies to create a bilayer-like environment

  • Detergent screening: Systematic testing of different detergents and mixed micelle systems

  • Temperature variation: Crystallization trials at elevated temperatures (30-60°C) to maintain protein stability

  • Phase separation: Utilizing temperature-dependent phase separation of detergent solutions

  • Antibody-mediated crystallization: Using antibody fragments to increase polar surface area

The hyperthermostable nature of MJ0972 may provide advantages during crystallization, as the protein is less likely to denature during the crystallization process compared to mesophilic membrane proteins.

How can I assess the structural integrity of purified MJ0972?

Multiple complementary approaches should be employed:

  • Circular dichroism (CD) spectroscopy: To monitor secondary structure content and thermal stability

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): To assess oligomeric state and homogeneity

  • Dynamic light scattering (DLS): To evaluate sample polydispersity

  • Intrinsic fluorescence spectroscopy: To monitor tertiary structure changes

  • Differential scanning calorimetry (DSC): To determine thermal transition points

  • Limited proteolysis: To identify flexible regions and stable domains

  • Negative-stain electron microscopy: To visualize protein-detergent complexes

For MJ0972 specifically, thermal stability assays should be conducted at temperatures ranging from 25°C to 95°C to establish the relationship between structure and the protein's hyperthermophilic origin.

What approaches can be used to determine the membrane topology of MJ0972?

Several experimental methods can map the membrane topology of MJ0972:

  • Cysteine scanning mutagenesis combined with accessibility assays using membrane-permeable and impermeable sulfhydryl reagents

  • Protease protection assays to identify exposed regions

  • Epitope insertion coupled with immunofluorescence in oriented membrane preparations

  • FRET-based approaches using fluorescently labeled domains

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify solvent-accessible regions

These experimental approaches should be complemented by computational prediction tools that account for the unique properties of archaeal membrane proteins.

How can I identify potential interaction partners of MJ0972 in M. jannaschii?

Multiple approaches can be employed to identify interaction partners:

  • Pull-down assays using recombinant tagged MJ0972 with M. jannaschii lysates

  • Bacterial two-hybrid systems adapted for high-temperature proteins

  • Cross-linking coupled with mass spectrometry (XL-MS) in native membranes

  • Co-immunoprecipitation with antibodies raised against MJ0972

  • Proximity labeling approaches with modified biotin ligases

  • Analysis of genomic context and gene neighborhood

  • Lipidomic analysis to identify preferentially bound lipids

The genetic system developed for M. jannaschii with tagged proteins could be particularly valuable for in vivo studies of protein-protein interactions .

What functional assays can be used to characterize the activity of MJ0972 given its uncharacterized function?

Since MJ0972 is an uncharacterized membrane protein, a systematic functional screening approach is recommended:

  • Transport assays: Screen for transport activity of various substrates using reconstituted proteoliposomes

  • Electrophysiological measurements: Assess channel or transporter activity using planar lipid bilayers

  • Binding assays: Test interactions with metabolites, cofactors, or signaling molecules

  • Enzyme activity screenings: Assess potential enzymatic activities related to membrane processes

  • Growth complementation: Express MJ0972 in model organisms with deleted membrane proteins of known function

  • Phenotypic analysis: Create knockout or overexpression strains in M. jannaschii using the established genetic system

  • Comparative analysis: Identify structural similarities with characterized membrane proteins

Given the methanogenic lifestyle of M. jannaschii, special attention should be paid to potential roles in energy metabolism, ion homeostasis, or transport activities related to C1 metabolism.

How can molecular dynamics simulations be optimized for studying hyperthermophilic membrane proteins like MJ0972?

Molecular dynamics (MD) simulations for hyperthermophilic proteins require specialized approaches:

  • Force field selection: Use force fields validated for high-temperature simulations

  • Temperature scaling: Gradually equilibrate the system at higher temperatures (80-85°C)

  • Membrane composition: Incorporate archaeal lipid models with ether linkages and branched isoprenoid chains

  • Extended timescales: Run simulations for longer periods to capture thermal adaptations

  • Multiple temperatures: Compare dynamics at physiological (80°C) and ambient temperatures

  • Explicit solvent models: Use water models optimized for high-temperature behavior

  • Ion parameterization: Adjust ion parameters to account for altered interaction energetics at high temperatures

These simulations can provide insights into the molecular basis of MJ0972's thermostability and functional mechanisms.

What are the most significant challenges in expressing and characterizing MJ0972, and how can they be addressed?

ChallengeDescriptionPotential Solutions
Proper folding in heterologous systemsMesophilic expression hosts may not provide appropriate folding conditionsUse thermophilic expression hosts; co-express chaperones; express at elevated temperatures
Membrane environment differencesArchaeal lipids differ significantly from bacterial or eukaryotic lipidsSupplement with archaeal lipids; use synthetic archaeal-like lipids; reconstitute in archaeal lipid extracts
Functional assays for unknown functionLack of knowledge about natural substrates or activitySystematic screening approaches; comparative analysis with distant homologs; contextual genomic analysis
Stability during purificationMembrane proteins can denature during extractionScreen multiple detergents; use nanodiscs or SMALPs; perform operations at elevated temperatures
Crystallization difficultiesMembrane proteins are challenging to crystallizeTry LCP crystallization; use antibody fragments; consider single-particle cryo-EM
Limited genetic toolsFewer tools for manipulating archaeal genesLeverage newly developed genetic system for M. jannaschii ; adapt tools from other archaeal systems

How can cryo-electron microscopy be optimized for structural studies of MJ0972?

For optimal cryo-EM studies of MJ0972, consider these specialized approaches:

  • Sample preparation:

    • Use detergent screening to identify optimal conditions for homogeneous particles

    • Test amphipols, nanodiscs, and SMALPs as alternatives to detergent micelles

    • Consider GraFix (gradient fixation) to stabilize complexes

  • Vitrification parameters:

    • Optimize blotting times and temperatures

    • Test different grid types (gold vs. copper, holey vs. continuous carbon)

    • Investigate the effects of additives that improve particle distribution

  • Data collection:

    • Implement energy filters to improve contrast

    • Use phase plates for smaller (<150 kDa) complexes

    • Consider collecting tilt series to address preferred orientation issues

  • Data processing:

    • Apply specialized algorithms for membrane protein processing

    • Use 3D variability analysis to capture conformational heterogeneity

    • Implement focused refinement for flexible regions

  • Functional insights:

    • Capture different functional states using substrate analogs or inhibitors

    • Use crosslinking to stabilize transient interactions

    • Reconstitute with functional partners identified in interaction studies

By implementing these optimized approaches, high-resolution structural information can be obtained to inform functional hypotheses about this uncharacterized membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.