Recombinant Methanocaldococcus jannaschii UPF0056 membrane protein MJ1677 (MJ1677)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant MJ1677 is generated via cloning the MJ1677 gene into a pET26b vector with a C-terminal hexa-histidine tag, followed by expression in E. coli BL21 cells . Post-induction with IPTG, membranes are isolated, solubilized, and purified using affinity chromatography. Critical steps include:

  • Reconstitution: Protein is resuspended in deionized water (0.1–1.0 mg/mL) with optional 50% glycerol for stability .

  • Quality Control: Validated by SDS-PAGE and mass spectrometry .

Research Applications

Recombinant MJ1677 serves as a tool for:

  1. Membrane Protein Studies:

    • Investigating thermostable protein-lipid interactions .

    • Benchmarking de novo membrane protein design algorithms (e.g., MeMDLM) .

  2. Biotechnological Development:

    • Engineering synthetic pathways in extremophiles .

  3. Drug Discovery:

    • Screening for inhibitors targeting archaeal membrane proteins .

Limitations and Future Directions

  • Functional Data Gap: No direct enzymatic or transport activity has been reported for MJ1677 .

  • Stability Challenges: Despite lyophilization, repeated freeze-thaw cycles degrade the protein .

  • Opportunities: Cryo-EM or X-ray crystallography could resolve its 3D structure, enabling mechanistic studies .

Comparative Analysis with Related Proteins

FeatureMJ1677MjNhaP1 (MJ0057)
FunctionUnknownNa+/H+ antiporter
Expression SystemE. coliE. coli
Structural DataNone8 Å cryo-EM map
ThermostabilityStable at -80°C Functional at 85°C

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our proteins is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple use. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1677; UPF0056 membrane protein MJ1677
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1677
Target Protein Sequence
MDLQYFILAFSSIFSILNPFGAVPVFITLTESYPKKERDLVAKKTVIYALAILLAFALFG EWILKFFGISLDAFKIAGGILLLLISLDMVRGQQEAKIHRKEIEAAYEIDEIALMPLATP LLAGPGSITACMVAMAEASDIGDKFLVILAILLSLGITYLTLLSAESVLDRIGRLGIRIL TRMMGLILTAIAVQMIVNGIRGALL
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1677

STRING: 243232.MJ_1677

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in protein research?

M. jannaschii has a large circular chromosome (1.66 mega base pairs) with a G+C content of 31.4%, plus large and small circular extra-chromosomes . As a thermophile growing in extreme conditions, its proteins often exhibit exceptional stability, making them valuable models for structural studies and biotechnological applications. The sequencing of M. jannaschii provided strong evidence supporting the three-domain classification of life, highlighting the unique features that distinguish Archaea from both Bacteria and Eukarya .

What is known about the UPF0056 membrane protein MJ1677?

The MJ1677 protein belongs to the UPF0056 family of membrane proteins identified in Methanocaldococcus jannaschii. UPF (Uncharacterized Protein Family) designations indicate protein families whose functions remain incompletely characterized. As a membrane protein from a thermophilic archaeon, MJ1677 presents both challenges and opportunities for research. Its thermostable nature makes it potentially valuable for structural studies, while its membrane localization introduces complexity in expression and purification protocols.

While specific functional annotations may be limited, membrane proteins in archaea often play crucial roles in energy metabolism, environmental sensing, and substance transport. In M. jannaschii specifically, membrane proteins may be involved in methanogenesis pathways, as this organism grows by producing methane as a metabolic byproduct and can only use carbon dioxide and hydrogen as primary energy sources . The study of such proteins contributes to our understanding of how extremophiles adapt to challenging environments and may reveal novel biochemical mechanisms.

What expression systems are recommended for recombinant production of MJ1677?

For recombinant production of archaeal membrane proteins like MJ1677, the selection of an appropriate expression system is critical. When working with thermophilic proteins, several considerations must be taken into account:

The optimal approach often involves testing multiple expression systems through design of experiments (DoE) methodologies, which allow systematic evaluation of expression conditions with reduced time and resource investment . Key variables to optimize include induction conditions, temperature, media composition, and fusion tags that may enhance solubility or facilitate purification.

How can Design of Experiments (DoE) be applied to optimize MJ1677 expression and purification?

Design of Experiments (DoE) offers a powerful approach for optimizing the expression and purification of complex proteins like MJ1677. Unlike the inefficient one-factor-at-a-time method, DoE enables researchers to evaluate multiple factors simultaneously, accounting for interaction effects while minimizing the number of experiments required .

For MJ1677 optimization, a typical DoE implementation would proceed as follows:

  • Factor Identification: Identify key variables affecting expression and purification. For archaeal membrane proteins, these typically include:

    • Induction parameters (inducer concentration, induction timing, temperature)

    • Growth media composition (carbon sources, salt concentration, supplements)

    • Buffer compositions for membrane extraction and protein purification

    • Detergent types and concentrations for membrane solubilization

  • Experimental Design Selection: Choose an appropriate design based on project goals:

    • Screening designs (Plackett-Burman, fractional factorial) for identifying significant factors with minimal experiments

    • Response surface methodology (RSM) for optimizing identified factors and mapping the response surface

    • Central composite or Box-Behnken designs for developing predictive models of optimal conditions

  • Response Variable Definition: Define clear, quantifiable measures of success, such as:

    • Protein yield (mg/L culture)

    • Purity (% as measured by SDS-PAGE or other analytical methods)

    • Functional activity (specific to the protein's known or predicted function)

    • Structural integrity (assessed by circular dichroism or thermal stability assays)

The implementation of DoE for MJ1677 optimization would typically involve specialized software packages that facilitate experimental design and analysis of results . This approach is particularly valuable for archaeal membrane proteins, which often require non-standard conditions for successful expression and purification.

What strategies can address the challenges of structural characterization for MJ1677?

Structural characterization of archaeal membrane proteins like MJ1677 presents several unique challenges. The following strategies address these challenges:

  • Detergent Screening: Systematic evaluation of detergents is crucial for maintaining protein stability while extracting from membranes. For thermophilic membrane proteins, detergents with longer alkyl chains often provide better stability. A DoE approach can efficiently identify optimal detergent conditions by examining:

    • Detergent type (maltoside, glucoside, phosphocholine-based)

    • Concentration ranges

    • Additives (lipids, stabilizing compounds)

  • Alternative Membrane Mimetics:

    • Nanodiscs: Provide a more native-like lipid bilayer environment

    • Amphipols: Can enhance stability for structural studies

    • Lipidic cubic phases: Particularly useful for crystallization of membrane proteins

    • SMALPs (styrene-maleic acid lipid particles): Allow extraction with native lipid environment

  • Crystallization Approaches:

    • LCP (Lipidic Cubic Phase) crystallization: Often successful for membrane proteins

    • Fragment-based approaches: Expressing stable domains separately

    • Surface entropy reduction: Mutating surface residues to enhance crystal contacts

  • Complementary Structural Methods:

    • Cryo-EM: Increasingly powerful for membrane protein structures

    • SAXS/SANS: Provides low-resolution structural information in solution

    • NMR: Useful for dynamics studies and smaller membrane proteins or domains

For thermophilic proteins like MJ1677, leveraging their inherent stability at higher temperatures can be advantageous, allowing studies under conditions that might denature mesophilic proteins but could provide better diffraction quality crystals or more stable samples for other structural techniques.

How can contradictions in experimental data for MJ1677 be systematically analyzed?

When working with complex proteins like MJ1677, researchers often encounter contradictory experimental results. A systematic approach to analyzing such inconsistencies involves:

  • Quantification of Contradiction: Rather than viewing data as simply consistent or inconsistent, implement metrics that quantify the degree of contradiction . Approaches include:

    • Consistency-based analysis focusing on consistent and inconsistent subsets of data

    • Incompatibility ratios calculated as |MI(Δ)|/|Δ|, where MI(Δ) represents the minimal inconsistent subsets of the knowledge base Δ

    • Information-theoretic measures that quantify the amount of contradiction

  • Source Reliability Assessment: When integrating data from multiple sources (different labs, techniques, or literature), evaluate each source's reliability:

    • Compare the degree of internal consistency within each data source

    • Identify the "least inconsistent" sources as potentially more reliable

    • Weight evidence based on methodological rigor and reproducibility

  • Experimental Design for Resolution:

    • Design targeted experiments specifically to address contradictions

    • Use orthogonal techniques to validate conflicting results

    • Implement statistical approaches like Bayesian analysis to formally incorporate prior contradictory evidence

  • Contradiction Visualization:

Data SourceObservationContradicting ObservationPotential Resolution Approach
Functional assaysMJ1677 shows activity at pH 6.5-7.5Structural stability observed at pH 5.0-6.0Design activity assays with stabilizing additives at lower pH
Expression studiesOptimal expression in E. coli at 18°CPoor folding observed at temperatures <25°CTest expression with chaperone co-expression at varied temperatures
Binding studiesStrong interaction with lipid XNo interaction detected with lipid XExamine dependence on detergent background and protein preparation method

This structured approach transforms contradictions from obstacles into opportunities for deeper understanding of the protein's properties and behavior under different experimental conditions.

What purification strategies are most effective for thermophilic archaeal membrane proteins like MJ1677?

Purification of thermophilic archaeal membrane proteins requires specialized approaches that account for both their membrane localization and thermostable nature. The following multi-stage purification strategy is recommended:

  • Membrane Extraction and Solubilization:

    • Initial cell lysis: For recombinant expression in E. coli, mechanical disruption (French press, sonication) in a buffer containing protease inhibitors is typically effective

    • Membrane isolation: Differential centrifugation to separate membrane fractions

    • Solubilization: Screen multiple detergents, with a focus on those proven effective for archaeal proteins (DDM, LDAO, LMNG)

    For MJ1677 specifically, leverage its thermophilic origin by incorporating a heat treatment step (65-75°C) after membrane isolation but before detergent solubilization, which can eliminate many mesophilic host proteins while preserving the target protein.

  • Initial Purification:

    • Immobilized metal affinity chromatography (IMAC): If MJ1677 is expressed with a polyhistidine tag

    • Ion exchange chromatography: Utilizing the predicted isoelectric point of MJ1677

    Buffer considerations should include stabilizing additives such as glycerol (10-20%), specific lipids that may be required for stability, and salt concentrations that mimic the native environment of M. jannaschii.

  • Advanced Purification:

    • Size exclusion chromatography: Critical for separating monomeric from aggregated protein and removing detergent micelles

    • Affinity chromatography: If specific interactions of MJ1677 are known

    Throughout purification, maintain a temperature higher than typically used for mesophilic proteins (room temperature to 30°C) to preserve native folding of this thermophilic protein.

  • Quality Assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Thermostability assays to confirm retention of thermophilic properties

    • Circular dichroism to verify secondary structure preservation

    • Mass spectrometry for precise molecular weight determination and post-translational modification analysis

This multi-stage approach, optimized through DoE methodologies, provides the best chance of obtaining pure, properly folded MJ1677 suitable for downstream functional and structural studies.

How can functional assays be developed for an uncharacterized protein like MJ1677?

Developing functional assays for uncharacterized proteins like MJ1677 requires a strategic approach combining bioinformatic predictions with experimental validation:

  • Bioinformatic Function Prediction:

    • Sequence homology: Identify characterized proteins with sequence similarity to MJ1677

    • Domain analysis: Identify conserved domains within the UPF0056 family

    • Structural prediction: Use AlphaFold or similar tools to predict structure and identify potential binding sites or catalytic regions

    • Genomic context: Analyze genes adjacent to MJ1677 in the M. jannaschii genome for functional hints

  • General Membrane Protein Functional Screening:

    • Transport assays: Reconstitute MJ1677 in liposomes with fluorescent probes to detect potential transport activity

    • Binding assays: Screen for interactions with metabolites relevant to M. jannaschii, particularly those involved in methanogenesis pathways

    • Thermal shift assays: Identify ligands that enhance thermal stability, suggesting specific binding

  • Archaeal-Specific Considerations:

    • Test function under conditions mimicking M. jannaschii's native environment (high temperature, pressure)

    • Consider interactions with archaeal-specific lipids and metabolites

    • Examine potential roles in methanogenesis or adaptation to extreme environments

  • Validation and Refinement:

    • Site-directed mutagenesis of predicted functional residues

    • Comparison with characterized members of the UPF0056 family

    • In vivo complementation studies in model organisms

Developing these assays should follow DoE principles, systematically optimizing conditions rather than changing one factor at a time . This approach is particularly important when working with proteins from extremophiles, as standard assay conditions may not capture their native functionality.

What analytical techniques are most informative for characterizing MJ1677's membrane interactions?

Understanding how MJ1677 interacts with membranes is crucial for characterizing its function. The following analytical techniques provide complementary information about these interactions:

  • Microscale Thermophoresis (MST):

    • Measures interactions between MJ1677 and various lipids

    • Advantages: Requires small sample amounts, works in detergent solutions

    • Implementation: Label MJ1677 with fluorescent tag, titrate with different lipids

    • Data interpretation: Binding curves yield dissociation constants (Kd) for specific lipids

  • Solid-State NMR:

    • Provides atomic-level details of protein-lipid interactions

    • Advantages: Can detect specific lipid binding sites and conformational changes

    • Implementation: Requires isotopically labeled protein reconstituted in lipid bilayers

    • Data interpretation: Chemical shift changes indicate specific interaction sites

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of MJ1677 that are protected or exposed in membrane environments

    • Advantages: Doesn't require protein modification, works with limited amounts

    • Implementation: Compare deuterium uptake in detergent micelles versus lipid nanodiscs

    • Data interpretation: Regions with reduced exchange in lipid environments indicate membrane interaction sites

  • Fluorescence Techniques:

    • Monitor environment-dependent changes in intrinsic or extrinsic fluorescence

    • Implementation options include:

      • Tryptophan fluorescence to monitor conformational changes upon membrane binding

      • FRET assays to measure distances between labeled sites in different membrane environments

      • Fluorescence quenching to determine depth of insertion into membranes

  • Cryo-Electron Microscopy:

    • Visualizes MJ1677 in membrane mimetics

    • Advantages: Can provide structural information in near-native environment

    • Implementation: Reconstitute protein in nanodiscs or liposomes

    • Data interpretation: Density maps reveal membrane topology and potential oligomeric states

Each technique provides different information, and combining multiple approaches yields the most comprehensive characterization of MJ1677's membrane interactions.

How should researchers approach contradictory data when studying novel archaeal proteins like MJ1677?

When studying novel archaeal proteins like MJ1677, contradictory data is often encountered due to the protein's unique properties and the challenging experimental conditions required. A systematic approach to resolving such contradictions includes:

  • Systematic Evaluation of Experimental Conditions:

    • Record comprehensive metadata for all experiments, including:

      • Buffer compositions (including minor components and contaminants)

      • Sample preparation history

      • Instrument calibration status

      • Temperature variations

    For archaeal proteins, small variations in conditions can have significant effects due to their adaptation to extreme environments.

  • Application of Formal Inconsistency Measures:

    • Implement quantitative approaches for measuring inconsistency, moving beyond binary consistent/inconsistent classifications

    • Calculate incompatibility ratios to determine how much of the data exhibits contradictions

    • Use these measures to identify the least problematic or most reliable experimental conditions

  • Hypothesis Generation for Resolving Contradictions:

    • Consider multiple functional states or conformations of MJ1677

    • Evaluate the possibility of post-translational modifications affecting function

    • Assess the impact of the experimental environment versus native conditions

    For example, if activity assays and structural studies yield contradictory results about optimal pH, consider that different conformational states may be favored under different conditions, each with distinct functional properties.

  • Integration Framework:

    • Develop a comprehensive model that accounts for seemingly contradictory observations

    • Use Bayesian approaches to formally update confidence in various hypotheses as new data emerges

    • Create explicit falsification experiments designed to discriminate between competing models

This approach transforms contradictions from experimental failures into valuable insights about the protein's behavior under different conditions, ultimately leading to a more complete understanding of MJ1677's properties and function.

What statistical approaches are most appropriate for analyzing MJ1677 experimental data?

Statistical analysis of experimental data for novel archaeal proteins requires approaches that account for the complexity and variability inherent in such systems. The following statistical frameworks are particularly valuable for MJ1677 research:

  • Design of Experiments (DoE) Statistical Analysis:

    • Analysis of variance (ANOVA) to identify significant factors affecting protein expression, purification, or activity

    • Response surface methodology (RSM) to map the relationship between experimental variables and outcomes

    • Principal component analysis (PCA) to identify covariant parameters and reduce dimensionality when many variables are monitored

  • Robust Statistics for Handling Outliers:

    • Non-parametric tests when data doesn't follow normal distributions

    • Bootstrapping approaches to establish confidence intervals without assuming specific distributions

    • Robust regression methods that are less sensitive to extreme values

  • Bayesian Approaches for Incremental Knowledge Building:

    • Bayesian inference to formally incorporate prior knowledge and update beliefs based on new data

    • Hierarchical Bayesian models to account for both within-experiment and between-experiment variability

    • Bayesian model comparison for evaluating competing hypotheses about MJ1677 function

  • Specialized Approaches for Specific Data Types:

Data TypeRecommended Statistical ApproachImplementation Considerations
Binding assaysGlobal fitting of multiple datasetsAccount for ligand depletion in tight-binding scenarios
Thermal stabilityBoltzmann sigmoid fitting with bootstrap error estimationCompare parameters across conditions using extra sum-of-squares F test
Activity measurementsMichaelis-Menten kinetics with competitive inhibition modelsUse progress curve analysis rather than initial rates when possible
Structural dataMaximum likelihood methods for model refinementImplement cross-validation to prevent overfitting

How can computational modeling complement experimental approaches in understanding MJ1677?

Computational modeling provides powerful complementary approaches to experimental studies of MJ1677, offering insights that may be difficult to obtain experimentally while generating testable hypotheses:

  • Structural Modeling and Analysis:

    • Homology modeling based on related structures in the UPF0056 family

    • Ab initio structure prediction using AlphaFold or RoseTTAFold

    • Molecular dynamics simulations in membrane environments to study conformational dynamics

    For thermophilic proteins like MJ1677, specialized force fields that account for high-temperature adaptations can improve simulation accuracy. Simulations at elevated temperatures (60-80°C) may reveal functionally relevant dynamics not observed at standard simulation temperatures.

  • Functional Prediction:

    • Active site identification through conservation analysis and pocket detection

    • Virtual screening against metabolite libraries from archaeal pathways

    • Quantum mechanics/molecular mechanics (QM/MM) modeling for potential catalytic mechanisms

    When studying archaeal proteins, incorporating organisms-specific metabolites is crucial for meaningful functional predictions.

  • Membrane Interaction Modeling:

    • Coarse-grained simulations of membrane insertion and protein-lipid interactions

    • Prediction of transmembrane regions and topology

    • Electrostatic analysis of membrane-facing surfaces

  • Integration with Experimental Data:

    • Refinement of computational models using low-resolution experimental constraints

    • In silico mutagenesis to guide experimental site-directed mutagenesis

    • Simulation of spectroscopic observables for direct comparison with experiments

  • Data-Driven Modeling Approaches:

    • Network analysis of protein-protein interaction predictions

    • Integration of transcriptomic data to identify co-regulated genes

    • Evolutionary analysis to identify functionally important residues

Computational approaches are particularly valuable for archaeal proteins like MJ1677, where experimental challenges related to expression, purification, and characterization under extreme conditions can limit the pace of discovery. The hypotheses generated through computational modeling can prioritize experiments, making the research process more efficient and focused.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.