Recombinant Methanocaldococcus jannaschii UPF0118 membrane protein MJ1177 (MJ1177)

Shipped with Ice Packs
In Stock

Description

3.1. Membrane Protein Biogenesis Studies

MJ1177 serves as a model for analyzing cotranslational integration mechanisms of archaeal membrane proteins. Key findings from analogous systems include:

  • Translocon Interactions: Long-range residue-specific effects during transmembrane helix integration, as observed in E. coli inner membrane proteins .

  • Chaperone Dependence: PAT complex (Asterix/CCDC47) likely assists in folding multipass membrane proteins by stabilizing semi-hydrophilic transmembrane domains .

3.3. Industrial Enzymology

  • Thermostability: Native M. jannaschii proteins exhibit stability ≥85°C, making MJ1177 a candidate for high-temperature biocatalysis .

Challenges and Limitations

  • Functional Annotation: No direct enzymatic or regulatory activity has been experimentally confirmed for MJ1177.

  • Partial Sequence: The recombinant protein lacks the full native structure, limiting insights into its physiological role.

  • Tag Variability: Affinity tags (e.g., His-tag) are not standardized, complicating comparative studies .

Future Directions

  • CRISPR-Based Genetic Systems: Leverage M. jannaschii genetic tools to study MJ1177 knockout phenotypes.

  • Proteasome Interactions: Investigate potential roles in protein degradation, given homolog MJ1176’s function as a proteasome activator .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ1177; Putative transport protein MJ1177
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1177
Target Protein Sequence
MRFEEFKYVRKGVIVGLLIMLLYIIWPFIDVLAYSCAFAYMALPVYNILRKKFNKTISAG LAISIYILPIMTITIYALLTFMEIILSFNTKSIEPYINEILSIYNSFMLERIINNEQIIA KYIDEFIKYLVSQFSGKIIDVGYLIVKVIMVLFLTFYFLRDGDKAKNLIISFVPDEYKEK MRIYLSYLHDSYKNLFISCVSLSIIITILSYIGYLILGVPYAELFAIITGIFALLPILGG WMVYISIAIYFFLIHDYTKAVFMFIYGELFLSIAPDFVIRPYLVKKEVDIHPVLVVIAFL MAPLSLGLSGFAIGPLVVGALNAFYLAKYRDKKI
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1177

STRING: 243232.MJ_1177

Protein Families
Autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the basic structural characteristics of MJ1177?

MJ1177 is a full-length protein of 334 amino acids with multiple transmembrane segments. The protein contains five highly conserved motifs (designated as Motifs A to E) that are not detected in the majority of AI-2E family members. These conserved motifs are critical for its function as a Na+(Li+)/H+ antiporter. Topological analysis using various prediction tools indicates that MJ1177 contains 7-8 transmembrane helices, with the N-terminus located in the cytoplasm and the C-terminus in the periplasm .

How does MJ1177 differ from other members of the AI-2E family?

While initially grouped with the AI-2E family, MJ1177 and its homologs represent an independent group now designated as the "Na+/H+ Antiporter Group." This group is distinguished by five highly conserved motifs (A-E) that are not found in most other AI-2E family members. Functional analysis has established that MJ1177 operates as a Na+(Li+)/H+ antiporter, a role significantly different from the autoinducer-2 export function of the prototype member of the AI-2E family, Escherichia coli YdgG .

What experimental designs are most appropriate for studying MJ1177 function?

For studying MJ1177 function, true experimental designs with proper controls are recommended. These include:

  • Pretest-Posttest Control Group Design: This approach compares antiport activity in cells expressing MJ1177 versus control cells before and after exposure to various ion concentrations or pH conditions.

  • Solomon Four-Group Design: This more complex design helps account for potential testing effects by including four groups:

    • Group 1: Pretest → MJ1177 expression → Posttest

    • Group 2: Pretest → No MJ1177 (control) → Posttest

    • Group 3: No pretest → MJ1177 expression → Posttest

    • Group 4: No pretest → No MJ1177 (control) → Posttest

  • Time-Series Experiment: This design is valuable for studying the kinetics of ion transport, measuring antiport activity at multiple timepoints after protein expression or activation .

The choice depends on specific research questions, with considerations for internal validity (causal inferences about MJ1177 function) and external validity (generalizability across conditions) .

How can site-directed mutagenesis be effectively designed to study functional motifs in MJ1177?

Site-directed mutagenesis experiments for MJ1177 should follow these methodological steps:

  • Identify conserved residues: Focus on polar or charged residues within the five conserved motifs (A-E), particularly E179, R182, K215, Q217, D251, R292, R293, E296, K298, and S307 located in Motifs A to D.

  • Develop targeted mutation strategy: Create single-residue mutations, replacing key amino acids with alanine or residues with opposing characteristics.

  • Use appropriate expression vectors: Utilize pET22b-P-UPF0118 as a template with specific primers.

  • Implement control systems: Include both wild-type MJ1177 and empty vector controls.

  • Verify mutations: Confirm all mutations by DNA sequencing before functional testing.

  • Assess antiport activity: Measure Na+(Li+)/H+ antiport activity in everted membrane vesicles prepared from E. coli KNabc transformants expressing wild-type or mutant proteins.

  • Evaluate protein expression: Use Western blotting to ensure differences in activity are not due to differences in expression levels .

What are the methodological approaches for membrane topology determination of MJ1177?

Determining the membrane topology of MJ1177 requires a multi-faceted approach:

  • Computational prediction: Apply multiple topology prediction algorithms, including HMMTOP, TMHMM, TMpred, PredTMR, SOSUI, Phyre2, and PredictProtein.

  • PhoA fusion analysis: Create fusions of MJ1177 with E. coli alkaline phosphatase (PhoA) at different positions. PhoA has high activity in the periplasm but low activity in the cytoplasm, making it an effective reporter for membrane orientation.

  • Experimental validation:

    • Express PhoA fusion constructs in phoA-deficient E. coli strains (e.g., DH5α)

    • Assess alkaline phosphatase activity using chromogenic substrates like 5-bromo-4-chloro-3-indolylphosphate

    • Quantify enzyme activity to determine periplasmic versus cytoplasmic localization

  • Terminal orientation verification: Create N-terminal (N-PhoA-UPF0118) and C-terminal (UPF0118-C-PhoA) fusions to confirm the orientation of each terminus. In MJ1177, this approach confirmed that the C-terminus is located in the periplasm while the N-terminus is in the cytoplasm .

How does the Na+(Li+)/H+ antiport activity of MJ1177 function mechanistically?

MJ1177 functions as a Na+(Li+)/H+ antiporter through a mechanism involving several key charged and polar residues. The antiport mechanism includes:

  • Ion exchange process: MJ1177 catalyzes the exchange of Na+ or Li+ ions for protons (H+) across the membrane, contributing to ion homeostasis.

  • pH-dependent activity: The antiport activity shows distinct pH dependency, with specific residues responsible for pH sensing.

  • Key functional residues: Critical residues for the antiport function include E179, R182, K215, Q217, D251 (in Motifs A-D), which play vital roles in ion coordination and transport. Mutation of these residues significantly impairs antiport activity.

  • Structural organization: The transmembrane helices form a channel-like structure that facilitates the passage of ions. The conserved motifs are positioned strategically within this structure to coordinate ion binding and translocation.

  • Conformational changes: The antiport mechanism likely involves conformational changes that alternately expose ion binding sites to opposite sides of the membrane, a common mechanism in secondary transporters .

What is the significance of the five conserved motifs in MJ1177 for Na+(Li+)/H+ antiport activity?

The five conserved motifs (A-E) in MJ1177 play distinct roles in its antiport function:

MotifKey ResiduesFunctional Significance
AE179, R182Critical for ion coordination and transport activity
BK215, Q217Essential for pH response and substrate recognition
CD251Important for ion binding and transport mechanism
DR292, R293, E296, K298, S307Involved in antiport activity and protein stability
EMultiple basic residuesNot directly involved in transport function but important for protein expression

These findings suggest that E179-R182-K215-Q217-D251-R292-R293-E296-K298-S307 located in Motifs A to D can serve as signature functional motifs to identify AI-2E family members that function as Na+(Li+)/H+ antiporters .

How can researchers distinguish between Na+(Li+)/H+ antiport activity and other potential functions of MJ1177?

To differentiate Na+(Li+)/H+ antiport activity from other potential functions of MJ1177, researchers should:

  • Conduct specific antiport assays: Utilize everted membrane vesicles prepared from E. coli KNabc (a strain deficient in major Na+/H+ antiporters) expressing MJ1177, and measure the dissipation of an artificially imposed pH gradient in response to the addition of Na+ or Li+ ions.

  • Perform ion specificity tests: Compare transport activity with different ions (Na+, Li+, K+, etc.) to determine ion selectivity.

  • Conduct pH dependence studies: Examine antiport activity across a range of pH values to establish the pH profile of the transporter.

  • Implement inhibitor studies: Use specific inhibitors of known transport mechanisms to rule out alternative functions.

  • Compare with characterized transporters: Conduct parallel experiments with well-characterized Na+/H+ antiporters and AI-2 exporters to benchmark activity profiles.

  • Assess growth complementation: Test whether MJ1177 can complement the growth defect of E. coli strains lacking Na+/H+ antiporters under high Na+ or Li+ conditions .

What expression systems are optimal for producing recombinant MJ1177 for structural and functional studies?

For optimal expression of recombinant MJ1177, researchers should consider:

  • E. coli expression systems: These have been successfully used for MJ1177 expression, particularly for functional studies. The in vitro E. coli expression system has been documented to produce functional protein .

  • Expression vectors: pET22b vectors with appropriate promoters have proven effective for MJ1177 expression .

  • Host strains: For functional studies, E. coli KNabc (lacking major Na+/H+ antiporters) is recommended, while BL21(DE3) or similar strains may be optimal for high-yield protein production.

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) may improve proper folding

    • Induction: IPTG concentration optimization (typically 0.1-0.5 mM)

    • Duration: 4-16 hours post-induction depending on temperature

  • Mammalian cell expression: For specific applications requiring post-translational modifications, mammalian cell expression systems have also been used successfully .

  • Affinity tags: N-terminal 10xHis-tag has been successfully employed for purification without interfering with function .

What are the critical parameters for maintaining structural integrity and function of MJ1177 during purification?

Maintaining MJ1177 structural integrity during purification requires careful attention to:

  • Buffer composition:

    • Use Tris/PBS-based buffers (pH 8.0)

    • Include stabilizers such as 6% Trehalose

    • Consider adding reducing agents (e.g., DTT at 0.5-1 mM) to prevent oxidation

  • Detergent selection:

    • Choose mild detergents compatible with membrane proteins

    • Consider detergent concentration to maintain protein solubility without denaturation

  • Temperature control:

    • Maintain samples at 4°C during purification steps

    • For storage, use -20°C/-80°C to prevent degradation

  • Aliquoting strategy:

    • Divide purified protein into small aliquots

    • Avoid repeated freeze-thaw cycles which can lead to denaturation

  • Storage conditions:

    • For liquid form: Stable for approximately 6 months at -20°C/-80°C

    • For lyophilized form: Stable for approximately 12 months at -20°C/-80°C

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol for long-term storage (with 50% being optimal)

How can researchers prepare functional membrane vesicles containing MJ1177 for transport assays?

Preparation of functional membrane vesicles containing MJ1177 for transport assays involves these methodological steps:

  • Transform expression construct: Transform E. coli KNabc with plasmids encoding MJ1177 or its variants.

  • Culture conditions: Grow transformed cells in LBK media to exponential phase under appropriate selective pressure.

  • Cell harvesting: Collect cells by centrifugation and resuspend in a buffer containing:

    • 10 mM Hepes-Tris (pH 7.0)

    • 140 mM choline chloride

    • 0.5 mM dithiothreitol

    • 250 mM sucrose

  • Cell disruption: Break cells using a French Press at 2000 psi system pressure. This creates everted membrane vesicles where the cytoplasmic side faces outward.

  • Differential centrifugation:

    • Remove cell debris by centrifugation at 5000 × g, 4°C for 10 min

    • Isolate membrane vesicles by ultracentrifugation at 100,000 × g for 1 hour

  • Resuspension: Carefully resuspend the membrane vesicle pellet in the same buffer used for cell resuspension.

  • Storage: Store prepared vesicles at -80°C until use for transport assays. Avoid repeated freeze-thaw cycles.

  • Quality control: Before transport assays, verify MJ1177 expression in the vesicles by Western blotting using antibodies against the protein or its affinity tag .

How can researchers apply problematization approaches to generate novel research questions about MJ1177?

To generate innovative research questions about MJ1177 beyond conventional gap-spotting, researchers should employ problematization approaches:

  • Challenge underlying assumptions: Question the current classification of MJ1177 as part of the AI-2E family by examining functional divergence.

  • Identify paradigmatic boundaries: Consider how MJ1177 might function across currently separated research domains (e.g., ion transport, cell signaling, stress response).

  • Apply counter-induction: Deliberately think against established theories about membrane transport mechanisms to generate novel hypotheses.

  • Examine context sensitivity: Investigate how MJ1177 function might vary across different physiological conditions or host organisms beyond what's currently studied.

  • Use interdisciplinary perspectives: Apply theories from other fields (e.g., physics of ion channels, evolutionary biology) to reinterpret MJ1177 function.

Following these approaches, researchers might ask questions such as:

  • How might MJ1177 function as both an antiporter and a signaling molecule in response to environmental stress?

  • Could MJ1177 serve as a model for designing synthetic transporters with enhanced ion specificity?

  • How does the evolutionary history of MJ1177 inform our understanding of membrane protein specialization in extremophiles?

What methodological innovations might advance our understanding of MJ1177 structure-function relationships?

Advanced methodological approaches for MJ1177 structure-function studies include:

  • Cryo-electron microscopy (Cryo-EM): Apply single-particle analysis to determine the high-resolution structure of MJ1177 in different conformational states during the transport cycle.

  • Molecular dynamics simulations: Develop computational models that predict ion transport pathways and conformational changes during antiport activity.

  • Time-resolved spectroscopy: Apply techniques such as FRET or EPR spectroscopy with strategically placed probes to monitor real-time conformational changes during transport.

  • Native mass spectrometry: Analyze protein-lipid interactions and oligomeric states under near-native conditions.

  • Electrophysiological methods: Develop patch-clamp techniques applicable to archaeal membrane proteins to measure ion currents directly.

  • Nanobody development: Generate conformation-specific nanobodies to stabilize and study specific transport states .

How might comparative analysis of UPF0118 family members across extremophiles inform evolutionary adaptation of ion transport mechanisms?

Comparative analysis of UPF0118 family members across extremophiles offers valuable insights into evolutionary adaptation of ion transport mechanisms:

  • Phylogenetic mapping: Construct comprehensive phylogenetic trees of UPF0118 family members across archaeal species, particularly those from diverse extreme environments (halophiles, thermophiles, acidophiles, etc.).

  • Sequence conservation analysis: Identify differential conservation patterns of the five signature motifs (A-E) in relation to environmental adaptations.

  • Environmental correlation studies: Analyze how specific amino acid substitutions in conserved motifs correlate with specific environmental parameters (temperature, pH, salinity) of the host organisms.

  • Experimental validation: Express and characterize UPF0118 homologs from different extremophiles to compare:

    • Ion selectivity (Na+, Li+, other ions)

    • pH dependence profiles

    • Temperature stability and activity ranges

    • Response to osmotic stress

  • Structural comparison: Apply homology modeling and structure prediction tools to identify structural adaptations that might explain functional differences.

  • Horizontal gene transfer analysis: Investigate potential horizontal gene transfer events that might have contributed to the distribution of UPF0118 transporters across prokaryotic domains.

  • Ancestral sequence reconstruction: Reconstruct putative ancestral UPF0118 sequences to study the evolutionary trajectory of this protein family and test the functional properties of reconstructed ancestral proteins .

This comparative approach could reveal how essential ion transport mechanisms have evolved specialized adaptations to extreme environmental conditions, potentially informing the design of engineered proteins for biotechnological applications.

How should researchers interpret contradictory results when analyzing MJ1177 function across different experimental systems?

When faced with contradictory results in MJ1177 functional studies, researchers should:

  • Systematically compare experimental conditions: Create a detailed table comparing expression systems, buffer compositions, temperature, pH, and ion concentrations across studies.

  • Evaluate methodological differences: Consider how different techniques for measuring antiport activity (fluorescence-based assays, growth complementation, direct ion measurements) might influence results.

  • Assess protein integrity: Verify that the recombinant protein is properly folded and integrated into membranes in each experimental system through techniques like circular dichroism or limited proteolysis.

  • Consider post-translational modifications: Investigate whether different expression systems result in variable post-translational modifications that might affect function.

  • Apply multiple independent techniques: Use orthogonal approaches to validate key findings, combining in vitro and in vivo methods.

  • Implement proper statistical analysis: Apply appropriate statistical tests to determine if differences are significant, with consideration for multiple testing corrections.

  • Develop a reconciliation model: Formulate a model that accounts for seemingly contradictory results by considering context-dependency of protein function .

What statistical approaches are most appropriate for analyzing site-directed mutagenesis data for MJ1177?

For rigorous analysis of site-directed mutagenesis data on MJ1177, researchers should employ these statistical approaches:

  • Multiple comparison corrections: When testing multiple mutations, apply Bonferroni or false discovery rate corrections to avoid Type I errors.

  • ANOVA with post-hoc tests: Use one-way ANOVA followed by Tukey's or Dunnett's tests to compare multiple mutants against wild-type controls.

  • Regression analysis for structure-function relationships: Apply multivariate regression to correlate specific physicochemical properties of substituted amino acids with functional parameters.

  • Bootstrap resampling: Implement bootstrap methods to estimate confidence intervals for functional parameters, particularly with limited replicates.

  • Hierarchical clustering: Group mutations based on their functional effects to identify residues that might participate in common functional modules.

  • Multidimensional scaling: Visualize the "functional distance" between different mutants based on multiple parameters (ion selectivity, pH dependence, etc.).

  • Bayesian analysis: Incorporate prior knowledge about related transporters to improve interpretation of subtle functional effects.

  • Power analysis: Ensure adequate statistical power by calculating the number of required replicates based on expected effect sizes .

How can researchers effectively integrate computational predictions with experimental data when studying MJ1177 structure and function?

Effective integration of computational predictions with experimental data for MJ1177 requires:

  • Iterative model refinement: Start with computational models based on homology or ab initio predictions, then refine these models based on experimental constraints from mutagenesis, spectroscopy, or low-resolution structural data.

  • Confidence-weighted integration: Assign confidence weights to both computational predictions and experimental measurements based on established error rates and methodological limitations.

  • Targeted validation experiments: Design experiments specifically aimed at testing the most uncertain aspects of computational models, rather than attempting comprehensive validation.

  • Joint visualization frameworks: Develop visualization tools that simultaneously display computational predictions and experimental results to identify consistencies and discrepancies.

  • Meta-analysis approaches: When multiple prediction methods are used (e.g., different topology prediction algorithms), apply formal meta-analysis techniques to derive consensus predictions.

  • Bayesian networks: Implement probabilistic graphical models that can incorporate both prior knowledge (computational predictions) and experimental evidence.

  • Machine learning integration: Train machine learning models on experimental data from related transporters to improve prediction accuracy for specific features of MJ1177.

  • Documentation of workflow: Maintain clear documentation of how computational predictions informed experimental design and how experimental results led to model refinements, creating a transparent research narrative .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.