Recombinant Methanocaldococcus jannaschii UPF0290 protein MJ1600 (MJ1600)

Shipped with Ice Packs
In Stock

Description

Core Characteristics of MJ1600

MJ1600 belongs to the UPF0290 protein family, which includes proteins of unknown function across diverse organisms. Key attributes include:

PropertyDetails
Source OrganismMethanocaldococcus jannaschii (thermophilic archaeon)
Sequence Length177 amino acids (full-length)
Expression HostE. coli (as a recombinant protein)
TagN-terminal 10xHis-tag for affinity purification
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C (avoid repeated freezing/thawing)

Key Production Parameters

ParameterDetails
Host StrainE. coli BL21(DE3) with pRI952 plasmid (for rare tRNA supplementation)
Purification MethodAffinity chromatography (via His-tag)
PurityHigh (suitable for ELISA, structural studies)
YieldNot explicitly reported; inferred as sufficient for research use

Structural Comparisons:
MJ1600 shares no obvious sequence similarity with well-characterized transmembrane proteins in M. jannaschii, such as helicases (e.g., MJ0669) or RNase P subunits . Its classification as a UPF0290 protein indicates a conserved but uncharacterized role, potentially linked to membrane-associated processes .

Research Applications and Functional Hypotheses

Despite limited functional data, MJ1600 serves as a model for studying archaeal transmembrane proteins and recombinant production challenges.

Hypothesized Roles

  1. Membrane Transport or Signaling:

    • The hydrophobic N-terminal region suggests involvement in membrane anchoring, possibly mediating substrate transport or sensory signaling.

  2. Protein-Protein Interactions:

    • The His-tagged recombinant form may interact with archaeal chaperones or cofactors, enabling structural studies .

Experimental Tools

MJ1600 is utilized in:

  • ELISA Kits: For antibody-based detection of UPF0290 proteins .

  • Structural Studies: As a soluble model for crystallization or cryo-EM, though no structures are currently reported.

Challenges and Future Directions

ChallengeImplications
Functional AmbiguityLimited homology to annotated proteins hinders hypothesis-driven research
SolubilityNative transmembrane conformation may differ from recombinant form
Thermal StabilityM. jannaschii’s thermophilic origin may require high-temperature assays

Research Gaps:

  • In Vivo Studies: No data exist on MJ1600’s localization or interaction partners in M. jannaschii.

  • Genetic Manipulation: Tools for M. jannaschii knockouts or overexpression are emerging but not yet applied to MJ1600 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
carS; MJ1600; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
carS
Target Protein Sequence
MFYRLLFASLWYILPAYVANASACIFGGGTPVDLGKNFIDGRRLIGNGVTYRGCIFGILC GTLVGLIQGILVDFNIFNSLDFYGTVLDHVILAFFLSVGAIVGDAVGSFIKRRLNIERGK PAPLLDQLDFVIGALAFGYIVAPIPYEMIIIICLFTVFVHLLGNIIAYKLGIKDVWW
Uniprot No.

Target Background

Function

Function: This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third step in archaeal membrane lipid biosynthesis involving ether bond formation.

Database Links

KEGG: mja:MJ_1600

STRING: 243232.MJ_1600

Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant MJ1600?

Based on methodologies used for other archaeal proteins from M. jannaschii, the following expression systems yield optimal results:

Expression SystemAdvantagesLimitationsRecommended Application
E. coli BL21(DE3)High yield, easy manipulationMay not fold correctly at mesophilic temperaturesInitial structural studies, antibody production
E. coli RosettaAddresses codon bias issuesHigher costExpression of full-length functional protein
Cell-free systemsAvoids toxicity issues, rapidLower yield, higher costDifficult-to-express constructs
Archaeal hostsNative-like conditionsTechnical challenges in manipulationFunctional studies requiring authentic folding

Methodological approach: Express the MJ1600 gene using a vector system that provides appropriate tags for purification (similar to approaches used for FlaI from M. jannaschii, using pTXB1 expression vector with intein and chitin-binding domain fusion) . Codon optimization may be necessary when using E. coli or other non-archaeal expression systems.

What purification strategies yield the highest purity and activity for recombinant MJ1600?

A multi-step purification strategy is recommended based on approaches used for other archaeal proteins:

  • Initial capture: Affinity chromatography using the fusion tag (His-tag, GST, or CBD-intein system)

  • Intermediate purification: Ion exchange chromatography (typically anion exchange)

  • Polishing step: Size exclusion chromatography

Purification StepMethodologyCritical ParametersQuality Control
Cell lysisSonication or French pressTemperature control (<4°C)SDS-PAGE verification
Affinity chromatographyIMAC (His-tag) or chitin resin (CBD)Buffer optimization, slow flow rateWestern blot
Tag cleavageTEV protease or intein-mediatedTemperature, time optimizationSDS-PAGE before/after
Ion exchangeQ Sepharose or equivalentpH gradient optimizationActivity assay
Size exclusionSuperdex 75/200Flow rate, column volumeDynamic light scattering

For optimal results, maintain samples at 4°C throughout purification, unless working with thermostability assays. Final storage should be in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

How can researchers accurately identify and quantify MJ1600 in complex protein mixtures?

Researchers should employ a combination of proteomic techniques:

  • Sample preparation: Two-dimensional gel electrophoresis of protein mixtures to separate MJ1600 from other proteins

  • Protein identification: In-gel digestion with trypsin followed by peptide extraction using sequential treatments with 2% trifluoroacetyl acid (TFA), 60% acetonitrile-0.1% TFA-40% water, and 100% acetonitrile

  • Mass spectrometry analysis: Quadrupole linear trap mass spectrometer (LTQ) with automated nanoscale LC separation on a 100-μm ID C18 column

  • Data analysis: Search against archaeal protein databases using algorithms like Sequest

For quantification purposes:

  • Stable isotope labeling approaches (such as SILAC) for relative quantification

  • Addition of known quantities of isotopically labeled synthetic peptides for absolute quantification

  • Label-free quantification using spectral counting or intensity-based methods

This methodology ensures accurate identification and quantification of MJ1600 even in samples with contaminating proteins from expression systems.

What approaches are most effective for determining the three-dimensional structure of MJ1600?

Given the nature of MJ1600 as a potential membrane protein from a thermophilic archaeon, researchers should consider these structural determination approaches:

MethodApplicabilityResolutionSample RequirementsTechnical Considerations
X-ray crystallographyHigh, if crystallizablePotentially atomic5-10 mg purified proteinMay require selenomethionine labeling for MAD phasing
Cryo-EMHigh for membrane proteins3-4Å possible100-500 μgMicelle/nanodisc incorporation may be necessary
NMR spectroscopyChallenging for sizeAtomic for dynamics15N, 13C-labeled proteinSize limitations may require domain analysis
AlphaFold2 predictionGood starting modelVariableSequence onlyValidate with experimental data

Methodological workflow:

  • Generate initial model using AlphaFold2

  • Express and purify protein (with selenomethionine labeling for crystallography)

  • Screen crystallization conditions or prepare samples for cryo-EM

  • Collect diffraction data or cryo-EM images

  • Process data using software packages like PHENIX, COOT and Refmac5

  • Validate structure through MolProbity or similar tools

  • Visualize final structure using PyMOL or equivalent software

For membrane proteins like MJ1600, consider detergent screening or lipid nanodisc incorporation to maintain native-like environment during structural studies.

How do environmental conditions affect the stability and structure of MJ1600?

As a protein from a thermophilic, anaerobic archaeon that lives in extreme environments, MJ1600's stability and structure are likely influenced by several parameters:

Environmental ParameterExpected EffectExperimental ApproachAnalytical Method
TemperatureEnhanced stability at high temperatures (60-85°C)Thermal shift assaysDifferential scanning fluorimetry
pHOptimal stability likely in range pH 6.0-7.5Activity/stability at various pHCircular dichroism spectroscopy
Salt concentrationMay require moderate-to-high saltStability in varying ionic strengthIntrinsic tryptophan fluorescence
Reducing conditionsMay contain disulfide bonds requiring reducing environmentActivity with/without reducing agentsSize exclusion chromatography
PressurePotential pressure adaptation mechanismsHigh-pressure biophysical studiesFTIR spectroscopy under pressure

Researchers should systematically evaluate these parameters, particularly when:

  • Designing storage and handling protocols

  • Establishing conditions for functional assays

  • Setting up crystallization or structural biology experiments

  • Comparing with homologous proteins from non-extremophiles

What computational approaches can help predict the function of MJ1600?

Given the uncharacterized nature of MJ1600 (UPF0290 family), computational approaches provide crucial insights:

Computational MethodApplication to MJ1600Tools/ResourcesOutput Interpretation
Sequence homologyIdentify related proteins with known functionsBLAST, HMMER, PSI-BLASTE-values <1e-10 suggest functional similarity
Structural homologyIdentify structural homologs regardless of sequenceDali, VAST, TM-alignZ-scores >8 indicate structural similarity
Motif/domain analysisDetect functional motifs in sequenceInterProScan, SMART, PfamConfidence scores and domain boundaries
Genomic contextAnalyze neighboring genes for functional associationsSTRING, KEGG, BioCycCo-occurrence patterns indicate related functions
Phylogenetic profilingIdentify co-evolving proteinsPhyloPro, CLIMESimilar profiles suggest functional relationships
Molecular dockingPredict potential binding partners or substratesAutoDock, HADDOCKBinding energy and interaction surface analysis

A multi-faceted approach combining these methods will provide the most robust functional predictions. Researchers should prioritize experimental validation of the highest-confidence predictions.

How can researchers design experiments to elucidate the biochemical function of MJ1600?

To systematically investigate the function of this uncharacterized protein, researchers should employ a hierarchical experimental approach:

  • Initial characterization:

    • Subcellular localization studies (membrane fractionation, immunolocalization)

    • Binding assays for common cofactors (ATP, GTP, metal ions)

    • Basic enzymatic activity screens (phosphatase, ATPase, protease, etc.)

  • Intermediate functional analysis:

    • Protein-protein interaction studies using pull-down assays or cross-linking MS

    • Gene knockout/knockdown studies in M. jannaschii or model organisms

    • Transcriptional response analysis under various conditions

  • Advanced functional characterization:

    • Site-directed mutagenesis of predicted functional residues

    • Substrate specificity profiling

    • Structure-function relationship studies combining structural data with activity assays

Functional CategoryExperimental ApproachRequired ControlsSuccess Indicators
Enzymatic activitySubstrate conversion assaysHeat-inactivated protein, no-substrateProduct formation rates
Binding functionIsothermal titration calorimetryUnrelated proteins, buffer-onlyBinding constants (Kd)
Structural roleIn vivo localization, interaction mappingLocalization of known proteinsCo-localization patterns
Regulatory functionGene expression changes upon depletionNon-targeting controlsConsistently altered pathways

How can MJ1600 contribute to understanding archaeal membrane biology and extremophile adaptation?

MJ1600's sequence characteristics suggest membrane association, making it valuable for investigating unique aspects of archaeal membrane biology:

Research DirectionExperimental ApproachExpected InsightsMethodological Considerations
Membrane architectureLipidomics of associating lipidsArchaeal-specific lipid interactionsMS-based lipidomics of co-purifying lipids
Temperature adaptationComparative studies with mesophilic homologsStructural features conferring thermostabilityThermal stability assays at varying temperatures
Pressure adaptationHigh-pressure protein folding studiesConformational changes under pressureSpecialized high-pressure equipment
Salt tolerance mechanismsStructure/function in varying salt concentrationsIon-coordination mechanismsActivity assays with different salt types
Evolutionary adaptationsAncestral sequence reconstructionEvolutionary trajectory of adaptationsComputational phylogenetics combined with experimental validation

Researchers can use MJ1600 as a model protein to understand how membrane proteins from extremophiles maintain functionality under harsh conditions. This has implications for biotechnology applications requiring enzymes that function under extreme conditions.

What synthetic biology applications might utilize engineered variants of MJ1600?

The thermostable nature of proteins from M. jannaschii makes MJ1600 a candidate for various biotechnological applications:

ApplicationEngineering ApproachPotential AdvantagesTechnical Challenges
BiosensorsFusion with reporter proteinsStable in harsh environmentsMaintaining function after fusion
BiocatalysisSubstrate specificity engineeringThermostable catalystsDetermining native activity first
NanomaterialsSelf-assembly properties engineeringHeat-resistant materialsControlling assembly process
Drug deliveryMembrane-penetrating peptide designStable delivery vehiclesBiocompatibility concerns
Protein scaffoldsStructure-based designThermostable scaffoldsMaintaining folding at lower temps

Methodological considerations for protein engineering include:

  • Rational design based on structural information

  • Directed evolution approaches optimized for thermophilic proteins

  • Computational design using physics-based force fields

  • Domain swapping with functionally characterized proteins

What considerations are important when measuring synthesis rates of MJ1600 using isotopic labeling?

Researchers can adapt methodologies used for measuring synthesis rates of mitochondrial proteins to study MJ1600:

Methodology StepTechnical ConsiderationsQuality ControlData Analysis Approach
In vivo labelingUse L-[ring-13C6]phenylalanine as tracerConfirm label incorporationCalculate protein-specific enrichment
Protein isolation2D gel electrophoresis of protein fractionVerify protein spot identityExcise spots for analysis
Peptide preparationIn-gel hydrolysis with 6M HClConfirm complete hydrolysisAmino acid recovery
Isotope measurementGC/MS/MS analysis of derivatized amino acidsInclude isotopic standardsCompare [m+6] to [m+2] ratios
Rate calculationIncorporate time points and enrichmentInclude biological replicatesFractional synthesis rate calculation

The synthesis rate is calculated using the formula:
FSR=EpEA×t×100FSR = \frac{E_p}{E_A \times t} \times 100

Where:

  • FSR = Fractional synthesis rate (%/hour)

  • Ep = Protein-bound phenylalanine enrichment

  • EA = Precursor pool enrichment

  • t = Time in hours

This methodology allows determination of protein turnover rates in various experimental conditions, providing insights into MJ1600 regulation.

How should researchers address contradictory findings in MJ1600 functional studies?

When facing contradictory results, researchers should employ a systematic troubleshooting approach:

Source of ContradictionInvestigation MethodResolution ApproachDocumentation Requirements
Protein preparation differencesComparative biochemical analysisStandardize purification protocolsDetailed methods reporting
Assay conditionsSystematic parameter variationEstablish condition-dependent effectsParameter matrices with results
Expression system artifactsCompare multiple expression systemsIdentify system-independent resultsControls from each system
Contaminating activitiesUltra-pure preparations, multiple controlsIdentify true MJ1600-specific activityNegative control data
Technical vs. biological variabilityStatistical analysis of replicatesIncrease replicate numberPower analysis justification

The scientific approach requires:

  • Thoroughly documenting all experimental conditions

  • Validating findings using multiple complementary methods

  • Considering biological context (native environment of M. jannaschii)

  • Collaborating with other labs to independently verify key findings

  • Publishing comprehensive methods and all data, including apparently contradictory results

What are the best practices for developing and validating antibodies against MJ1600?

Developing effective antibodies against archaeal proteins requires special considerations:

Antibody Development StepMethodological ApproachValidation CriteriaCommon Pitfalls
Antigen selectionUse recombinant full protein or unique peptidesSequence uniqueness analysisCross-reactivity with homologs
Immunization strategyMultiple host species, adjuvant optimizationTiter monitoringPoor immunogenicity
Antibody purificationAffinity chromatography against antigenSpecificity testingNon-specific binding
Validation in archaeal samplesWestern blot, immunoprecipitationSignal in expected size rangeBackground in complex samples
Cross-reactivity testingTest against related proteinsSignal-to-noise ratioFalse positives with homologs

Key methods for antibody validation:

  • Western blotting against purified protein and cell extracts

  • Immunoprecipitation followed by mass spectrometry

  • Immunofluorescence with pre-immune serum controls

  • Testing with knockout/knockdown samples when available

  • Epitope mapping to confirm binding specificity

How can researchers develop a reproducible in vitro system to study MJ1600 activity?

Establishing a defined in vitro system is crucial for characterizing MJ1600 function:

System ComponentConsiderationsOptimization ApproachQuality Control
Protein preparationPurity, tag influence, storageSystematic purification optimizationSDS-PAGE, mass spec verification
Buffer compositionpH, salt, reducing agentsMulti-parameter matrix testingStability and activity monitoring
Membrane mimeticsDetergents, nanodiscs, liposomesScreen multiple membrane mimeticsDynamic light scattering
Assay developmentSensitivity, specificity, throughputAssay miniaturization and validationZ-factor determination
Reaction conditionsTemperature, time course, concentrationResponse surface methodologyLinearity and reproducibility

For membrane proteins like MJ1600, particular attention should be paid to:

  • Reconstitution in appropriate membrane mimetics

  • Maintaining native-like lipid environment

  • Temperature considerations (M. jannaschii is thermophilic)

  • Anaerobic conditions when relevant

  • Controls for non-specific effects of detergents or lipids

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.