Recombinant Methanocaldococcus jannaschii UPF0333 protein MJ0832.1 (MJ0832.1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii UPF0333 Protein MJ0832.1

The Recombinant Methanocaldococcus jannaschii UPF0333 protein MJ0832.1 is a protein derived from the hyperthermophilic methanarchaeon Methanocaldococcus jannaschii. This organism is known for its ability to thrive in extreme environments, such as deep-sea hydrothermal vents, where temperatures can exceed 100°C. The protein MJ0832.1 is part of a larger operon and belongs to the UPF0333 family, which is characterized by its conserved sequence across different species but lacks a well-defined function.

Protein Structure and Function

While specific structural data for MJ0832.1 is not readily available, proteins from the UPF0333 family are generally conserved across different domains of life, suggesting they may play fundamental roles in cellular processes. The structure of such proteins typically determines their function, as seen in other proteins where the three-dimensional shape influences interactions with other molecules .

Protein FeatureDescription
Sequence ConservationHighly conserved across different species, indicating potential fundamental roles.
Operon StructurePart of a split operon, suggesting coordinated expression with other genes .
FunctionCurrently undefined, but likely involved in basic cellular processes given its conservation.

Future Directions

Future research on MJ0832.1 should focus on determining its structure and function, potentially using techniques like X-ray crystallography or NMR spectroscopy. Additionally, functional studies could involve genetic knockouts or overexpression in M. jannaschii to elucidate its role in cellular processes.

Future Research Directions
Structural Determination
Functional Analysis
Comparative Studies

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0832.1; UPF0333 protein MJ0832.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0832.1
Target Protein Sequence
MLKFRKRGQISLEFSLLFLGVLLAIVIAVGYPGMFGFNKTVSISSMSLAHAAVSKMKQNI ELVSSADEGTMKIVYIKCPPGTWGANNNILYFYRDGNIKFNITAKCDINIILNGNKTVST PKIIIANITKIDETHVIVTLYQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0333 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in molecular biology?

Methanocaldococcus jannaschii is an archaeal organism that holds significant importance in molecular biology as the first member of the Archaea domain to have its genome sequenced. This thermophilic methanogen possesses a circular chromosome that is 1.66 mega base pairs long with a G+C content of 31.4%, along with a large circular extra-chromosome and a small circular extra-chromosome . Its sequencing, led by Craig Venter at TIGR using whole-genome shotgun sequencing, provided compelling evidence for the three-domain classification of life (Bacteria, Archaea, and Eukarya) . The unique features discovered in M. jannaschii's genome have made it an invaluable model organism for studying archaeal biochemistry, extremophile adaptation mechanisms, and evolutionary relationships across domains of life.

What are the basic structural characteristics of MJ0832.1 protein?

The MJ0832.1 protein is classified as a UPF0333 family protein with a molecular weight of 15,689 Da . It is annotated as a "class III signal peptide-containing protein" according to NCBI data . The protein likely contains specific structural domains characteristic of the UPF0333 family, though detailed structural information is limited in the available literature. The presence of a class III signal peptide suggests its involvement in protein transport or localization within the archaeal cell. When expressed recombinantly, the protein typically contains added N-terminal and potentially C-terminal tags to facilitate purification and detection in experimental settings . Three-dimensional structural information for this protein may be available through ModBase, as indicated by the product information associated with accession number P81322 .

What expression systems are suitable for recombinant production of MJ0832.1?

The recombinant MJ0832.1 protein can be successfully expressed in multiple heterologous systems including E. coli, yeast, baculovirus, or mammalian cell platforms . The selection of an appropriate expression system depends on several experimental factors including required protein yield, downstream applications, and post-translational modification requirements. E. coli systems typically offer high yield and economic advantages for basic structural studies, while eukaryotic expression systems may be preferable when studying protein-protein interactions or when proper folding requires specific chaperones. When expressing this archaeal protein, researchers should consider that M. jannaschii is a thermophilic organism, which may affect optimal folding conditions for the recombinant protein regardless of the chosen expression system.

How does M. jannaschii's thermophilic nature affect the properties of its proteins including MJ0832.1?

M. jannaschii is a thermophilic methanogen that grows optimally at elevated temperatures . This thermophilic nature has profound implications for the properties of its proteins, including MJ0832.1. Proteins from thermophilic organisms typically exhibit enhanced thermal stability through various structural adaptations including increased hydrophobic interactions, additional salt bridges, more compact folding, and reduced flexibility in loop regions. For MJ0832.1 specifically, these thermostable properties may affect experimental conditions required for proper folding, storage stability, and functional assays. Researchers working with this recombinant protein should consider performing thermal stability assays to determine optimal conditions for maintaining native-like conformation and functionality, especially when conducting enzymatic or structural studies at varying temperatures.

What methodological approaches can resolve common expression challenges with recombinant MJ0832.1?

Expressing recombinant archaeal proteins like MJ0832.1 often presents several technical challenges that require methodological refinements. Based on experiences with similar archaeal proteins, researchers might encounter issues with protein misfolding, inclusion body formation, or low yield. To address these challenges, a multi-faceted approach is recommended:

  • Codon optimization: Adapt the coding sequence to the codon usage bias of the expression host to enhance translation efficiency.

  • Expression temperature modulation: Lower induction temperatures (16-20°C) often improve folding of thermophilic proteins in mesophilic hosts.

  • Solubility enhancement: Employ fusion partners such as SUMO, MBP, or thioredoxin to increase solubility.

  • Chaperone co-expression: Co-express molecular chaperones that facilitate proper protein folding.

  • Buffer optimization: Include specific ions (particularly metal ions) that might be required for proper folding of the archaeal protein.

For purification, a stepwise protocol incorporating heat treatment (leveraging the thermostability of the protein) followed by affinity chromatography and size exclusion chromatography typically yields protein with ≥85% purity as determined by SDS-PAGE .

How can researchers effectively analyze the functional characteristics of MJ0832.1 in the context of M. jannaschii's metabolic pathways?

Analyzing the functional characteristics of MJ0832.1 requires an integrated approach that considers its potential role in M. jannaschii's unique metabolic pathways. As a class III signal peptide-containing protein , MJ0832.1 may participate in protein transport processes related to M. jannaschii's methanogenesis pathways or other archaeal-specific metabolic functions.

A comprehensive functional analysis protocol should include:

  • Bioinformatic analysis: Perform comparative sequence analysis against characterized proteins from other archaea to identify conserved domains and potential functional motifs.

  • Protein-protein interaction studies: Employ pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems adapted for archaeal proteins to identify potential interaction partners within M. jannaschii's proteome.

  • Metabolic context analysis: Consider MJ0832.1's possible involvement in hydrogenase systems, as M. jannaschii possesses several different hydrogenases including 5,10-methenyltetrahydromethanopterin hydrogenase, ferredoxin hydrogenase, and coenzyme F420 hydrogenase .

  • Localization studies: Determine the subcellular localization of MJ0832.1 in M. jannaschii or in reconstituted systems, which may provide clues to its function.

  • Functional reconstitution: Attempt to reconstruct relevant metabolic reactions in vitro using purified MJ0832.1 and potential interaction partners.

What structural biology techniques are most appropriate for elucidating the three-dimensional structure of MJ0832.1?

Given the unique properties of archaeal proteins like MJ0832.1, a multi-technique approach to structural determination is recommended:

The thermostable nature of MJ0832.1 may actually be advantageous for structural studies, as thermostable proteins often exhibit reduced flexibility and increased stability during purification and crystallization procedures.

How can researchers investigate potential interactions between MJ0832.1 and other components of M. jannaschii's inteins and novel metabolic pathways?

M. jannaschii contains a large number of inteins (19 discovered in one study) and exhibits several novel metabolic pathways, including those for synthesis of methanogenic cofactors, riboflavin, and unique amino acid synthesis pathways . Investigating potential interactions between MJ0832.1 and these systems requires specialized approaches:

  • Intein interaction analysis: To determine if MJ0832.1 contains or interacts with inteins:

    • PCR amplification with primers designed to detect intein sequences within MJ0832.1

    • Expression of protein with and without putative intein sequences to observe differences in splicing patterns

    • Western blotting to detect potential post-translational processing related to intein activity

  • Metabolic pathway association:

    • Isotope labeling experiments to trace potential involvement of MJ0832.1 in carbon flux

    • Activity assays in the presence of known methanogenic cofactors

    • Comparative proteomics between wild-type and MJ0832.1-depleted/overexpressed conditions

  • Co-expression network analysis:

    • Analyze transcriptomic data to identify genes co-expressed with MJ0832.1 under various growth conditions

    • Construct protein-protein interaction networks based on experimental and computational predictions

What purification strategy yields the highest purity and activity for recombinant MJ0832.1?

Based on the available data and experience with similar archaeal proteins, the following optimized purification protocol is recommended for obtaining high-purity, active recombinant MJ0832.1:

Step 1: Initial Clarification

  • Harvest cells expressing recombinant MJ0832.1 by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in lysis buffer containing protease inhibitors

  • Lyse cells using sonication or high-pressure homogenization

  • Centrifuge lysate (20,000 × g, 30 min, 4°C) to remove cell debris

Step 2: Heat Treatment

  • Leverage the thermostable nature of MJ0832.1 by heating the clarified lysate (65°C, 20 min)

  • Remove precipitated host proteins by centrifugation (20,000 × g, 30 min, 4°C)

Step 3: Affinity Chromatography

  • Apply supernatant to appropriate affinity resin based on the tag incorporated in the recombinant protein

  • For His-tagged MJ0832.1: Use Ni-NTA resin with imidazole gradient elution

  • Wash extensively to remove non-specifically bound proteins

Step 4: Size Exclusion Chromatography

  • Apply affinity-purified protein to a size exclusion column (Superdex 75 or 200)

  • Collect fractions and analyze by SDS-PAGE

Step 5: Quality Control

  • Assess purity by SDS-PAGE (should achieve ≥85% purity)

  • Confirm identity by mass spectrometry

  • Verify proper folding by circular dichroism or thermal shift assay

This protocol typically yields protein suitable for structural and functional studies. For applications requiring exceptionally high purity, an additional ion-exchange chromatography step may be incorporated between the affinity and size exclusion steps.

What are the optimal storage conditions for maintaining stability and activity of purified MJ0832.1?

The thermophilic origin of MJ0832.1 influences its optimal storage conditions. Based on experience with similar archaeal proteins, the following storage recommendations maximize stability and activity retention:

Short-term storage (up to 1 week):

  • Store at 4°C in an appropriate buffer (typically 20-50 mM Tris or phosphate buffer, pH 7.5-8.0, 100-150 mM NaCl)

  • Include reducing agents (1-5 mM DTT or 0.5-2 mM TCEP) if the protein contains cysteine residues

  • Consider adding glycerol (10%) to prevent aggregation

Long-term storage:

  • Store at -20°C or preferably -80°C

  • Add cryoprotectants such as glycerol (final concentration 20-25%) or sucrose (10-15%)

  • Aliquot in small volumes to avoid repeated freeze-thaw cycles

Lyophilization option:

  • Lyophilization may be appropriate for extended storage

  • Add excipients like trehalose or sucrose (5-10%) to maintain structure during freeze-drying

  • Store lyophilized protein at -20°C with desiccant

Prior to using stored protein, centrifuge briefly (10,000 × g, 5 min, 4°C) to remove any potential aggregates . For critical applications, verify protein integrity after storage by analytical size exclusion chromatography or dynamic light scattering to detect potential aggregation.

How can researchers design experiments to investigate the potential role of MJ0832.1 in thermoadaptation?

Given M. jannaschii's thermophilic nature, investigating MJ0832.1's potential role in thermoadaptation requires carefully designed experiments that address both structural and functional aspects:

Structural thermostability analysis:

  • Perform differential scanning calorimetry (DSC) to determine melting temperature (Tm)

  • Conduct circular dichroism (CD) spectroscopy at increasing temperatures to monitor secondary structure changes

  • Use intrinsic fluorescence spectroscopy to track tertiary structure alterations with temperature

Comparative analysis:

  • Clone and express homologous proteins from mesophilic archaea or bacteria

  • Compare thermostability parameters between thermophilic and mesophilic variants

  • Create chimeric proteins to identify domains responsible for thermostability

Molecular dynamics simulation:

  • Perform in silico analysis of protein motion at different temperatures

  • Identify key residues and interactions contributing to thermostability

  • Design mutagenesis experiments based on computational predictions

Functional thermostability:

  • Develop activity assays for MJ0832.1 (if function is known)

  • Measure activity at different temperatures (20-95°C)

  • Determine temperature optima and compare to M. jannaschii's growth temperature

In vivo complementation:

  • Attempt expression of MJ0832.1 in mesophilic hosts under thermal stress

  • Assess whether MJ0832.1 confers increased thermotolerance

What bioinformatic approaches can predict potential functions of MJ0832.1 based on its sequence and structural features?

Given the limited direct functional information available for MJ0832.1, a comprehensive bioinformatic analysis can provide valuable insights into its potential functions:

Sequence-based prediction approaches:

  • Homology detection: Use PSI-BLAST, HHpred, and HMMER to identify remote homologs with known functions

  • Domain analysis: Employ InterProScan, SMART, and Pfam to identify conserved domains and motifs

  • Sequence conservation: Apply ConSurf or similar tools to identify evolutionarily conserved residues that may be functionally important

  • Genomic context analysis: Examine neighboring genes in the M. jannaschii genome to infer potential functional associations

Structure-based prediction approaches:

  • Structural homology modeling: Generate 3D models using ModBase or I-TASSER based on known structures

  • Binding site prediction: Use CASTp, SiteMap, or FTSite to identify potential active or binding sites

  • Molecular docking: Perform in silico docking with potential ligands or substrates

  • Electrostatic surface analysis: Calculate electrostatic potentials to identify potential interaction surfaces

Integrated analysis:

  • Phylogenetic profiling: Identify co-occurrence patterns across species

  • Network-based approaches: Integrate protein-protein interaction, gene co-expression, and metabolic networks

  • Text mining: Extract potential functional associations from scientific literature

This multi-layered bioinformatic approach can generate testable hypotheses about MJ0832.1's function that can guide subsequent experimental investigations.

How can researchers effectively compare MJ0832.1 with homologous proteins across different domains of life?

Comparative analysis of MJ0832.1 with homologs from different domains provides evolutionary insights and functional clues. The following methodological approach facilitates robust comparison:

Sequence-based comparison workflow:

  • Identify homologs using iterative sequence search tools (PSI-BLAST, HMMER) across archaeal, bacterial, and eukaryotic databases

  • Perform multiple sequence alignment using archaeal-optimized alignment algorithms

  • Generate phylogenetic trees to visualize evolutionary relationships

  • Identify conserved residues and domain architectures across domains

Structural comparison methodology:

  • Obtain or predict structures of homologs from each domain

  • Perform structural alignment using tools like DALI, TM-align, or FATCAT

  • Calculate RMSD values to quantify structural conservation

  • Identify structurally conserved regions that may indicate functional importance

Comparative genomics approach:

  • Analyze genomic context of homologs across domains

  • Identify conserved gene neighborhoods or operonic structures

  • Look for domain fusion events that may indicate functional relationships

Experimental validation:

  • Express selected homologs from different domains

  • Compare biochemical properties (stability, activity, substrate specificity)

  • Perform complementation studies to test functional conservation

The table below illustrates a typical comparative analysis framework:

FeatureArchaeal MJ0832.1Bacterial HomologsEukaryotic Homologs
Sequence Identity100% (reference)Varies (typically 30-50%)Varies (typically 20-35%)
Domain ArchitectureUPF0333, signal peptide[To be determined][To be determined]
Genomic Context[To be determined][To be determined][To be determined]
ThermostabilityHighVariableTypically lower
Expression SystemE. coli, yeast, baculovirus, mammalianNative hostsNative hosts

This systematic comparison provides a foundation for understanding the evolutionary history and potential functional divergence of the UPF0333 protein family across domains of life.

How might MJ0832.1 be utilized in synthetic biology applications?

The thermostable nature and unique properties of archaeal proteins like MJ0832.1 offer several potential applications in synthetic biology:

Thermostable protein engineering platform:

  • Use MJ0832.1 as a scaffold for designing thermostable enzymes for industrial processes

  • Identify thermostability-conferring motifs that could be transferred to mesophilic proteins

  • Develop archaeal-based cell-free protein synthesis systems that operate at elevated temperatures

Metabolic engineering applications:

  • Incorporate MJ0832.1 into synthetic methanogenic pathways if involved in related processes

  • Explore potential for creating thermostable biosensors based on signal peptide properties

  • Development of high-temperature bioprocessing systems incorporating archaeal components

Structural biology tools:

  • Utilize as a model system for studying protein folding at high temperatures

  • Develop as a potential fusion partner to enhance thermostability of other proteins

  • Explore applications in crystallization chaperone technology

Biotechnological applications:

  • Investigate potential antimicrobial properties based on archaeal-specific features

  • Explore potential for bioremediation applications at elevated temperatures

  • Develop archaeal expression systems optimized for producing thermostable proteins

These applications leverage the unique properties of archaeal proteins while addressing current challenges in synthetic biology relating to system robustness, thermal stability, and novel functional elements.

What are the current gaps in understanding MJ0832.1 and how might future research address these gaps?

Despite the availability of basic information about MJ0832.1, several significant knowledge gaps remain that warrant further investigation:

Functional characterization gaps:

  • Precise biological function: The exact role of MJ0832.1 in M. jannaschii remains uncharacterized

  • Interaction partners: The protein-protein interaction network involving MJ0832.1 is unknown

  • Regulatory mechanisms: How expression of MJ0832.1 is regulated in response to environmental conditions

Structural knowledge gaps:

  • High-resolution structure: Detailed atomic structure of MJ0832.1 has not been reported

  • Conformational dynamics: Information about flexibility, domain movements, and potential allostery is lacking

  • Ligand binding sites: Potential binding pockets and substrate specificity remain uncharacterized

Proposed research directions:

  • Functional genomics approach:

    • CRISPR-based manipulation of MJ0832.1 in M. jannaschii or related archaeal models

    • Transcriptomic and proteomic profiling under various conditions

    • Metabolomic analysis to identify associated metabolic pathways

  • Structural biology initiatives:

    • High-resolution structure determination using cryo-EM or X-ray crystallography

    • Hydrogen-deuterium exchange mass spectrometry to map flexible regions

    • NMR studies to characterize dynamics

  • Evolutionary perspectives:

    • Comprehensive phylogenetic analysis of UPF0333 family across archaea

    • Ancestral sequence reconstruction to understand evolutionary history

    • Comparative analysis of signal peptide-containing proteins across extremophiles

  • Systems biology integration:

    • Network analysis incorporating transcriptomic, proteomic, and metabolomic data

    • In silico modeling of M. jannaschii metabolic pathways including MJ0832.1

    • Machine learning approaches to predict function from integrated datasets

What are the most promising research directions for MJ0832.1 based on current knowledge?

Based on the available information about MJ0832.1 and the broader context of M. jannaschii biology, several promising research directions emerge:

  • Functional characterization through comparative genomics: Systematic analysis of UPF0333 family proteins across archaeal species to identify conserved features and potential functions. This approach could leverage the complete genomic information available for M. jannaschii to place MJ0832.1 in its proper biological context.

  • Structural biology investigations: Determination of MJ0832.1's three-dimensional structure would significantly advance understanding of its function. The protein's relatively small size (15,689 Da) makes it amenable to various structural biology techniques including X-ray crystallography and NMR spectroscopy.

  • Protein-protein interaction mapping: As a signal peptide-containing protein , MJ0832.1 likely interacts with other cellular components. Systematic identification of these interaction partners would provide valuable functional insights.

  • Investigation of thermoadaptation mechanisms: Analysis of how MJ0832.1's structure contributes to thermostability could advance understanding of archaeal adaptation to extreme environments and potentially inform protein engineering applications.

  • Integration with methanogenesis studies: Exploration of potential connections between MJ0832.1 and M. jannaschii's methanogenic pathways could reveal roles in energy metabolism or related processes.

These research directions leverage M. jannaschii's position as the first archaeal organism to have its genome sequenced and build upon the growing body of knowledge about archaeal biology and extremophile adaptations.

How can researchers integrate knowledge about MJ0832.1 with broader archaeal biology research?

Integrating MJ0832.1 research with the broader field of archaeal biology requires multidisciplinary approaches and collaborative strategies:

  • Contribution to archaeal model systems: Incorporate MJ0832.1 studies into established archaeal model organism frameworks, particularly those focused on thermophilic methanogens. This integration would contextualize findings within archaeal cellular processes.

  • Evolutionary biology perspectives: Use MJ0832.1 as a case study for investigating protein evolution in extremophiles, particularly regarding domain architecture and adaptation to high temperatures.

  • Systems biology integration: Position MJ0832.1 within the broader metabolic and regulatory networks of M. jannaschii, potentially revealing connections to the organism's unique biochemical adaptations for methanogenesis .

  • Synthetic biology applications: Explore potential biotechnological applications leveraging MJ0832.1's thermostable properties, particularly in high-temperature bioprocesses or protein engineering.

  • Astrobiology connections: Given M. jannaschii's extremophilic nature, integrate MJ0832.1 research with studies on potential life in extreme environments, both terrestrial and extraterrestrial.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.