Recombinant Methanocaldococcus jannaschii UPF0333 protein MJ0835.1 (MJ0835.1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

MJ0835.1 is produced via recombinant expression in heterologous hosts, with protocols optimized for high yield and stability:

ParameterDetails
Host OrganismsE. coli , yeast , mammalian cells
TaggingN-terminal His-tag (standard) ; variable tags determined during production
Purity>85% (SDS-PAGE)
Yield50 µg–1 mg (varies by batch and host)
Storage BufferTris-based buffer with 50% glycerol (lyophilized) ; Tris/PBS + 6% trehalose (liquid)

Key Considerations:

  • Stability: Repeated freeze-thaw cycles degrade activity; store at -20°C/-80°C .

  • Reconstitution: Dissolve lyophilized protein in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Functional and Research Applications

Despite lacking defined enzymatic activity, MJ0835.1 serves as a model for studying:

Enzymatic Profiling

  • Assay Development: Recombinant MJ0835.1 is used to screen for novel catalytic functions (e.g., hydrolysis, redox reactions) in hyperthermophilic systems .

  • Kinetic Analysis: While no direct activity data exists, homologs like PAN (proteasome-activating nucleotidase) exhibit ATPase activity (V<sub>max</sub> = 3.5–5.8 μmol/min/mg) .

Genetic Engineering

  • Tagged Variants: N-terminal His-tags enable affinity purification, as demonstrated in M. jannaschii for homologous overexpression .

  • Shuttle Vectors: Recombinant constructs facilitate gene knockout studies in methanococci .

Research Challenges and Gaps

  1. Functional Ambiguity: No catalytic role or substrate has been identified for native MJ0835.1.

  2. Sequence Discrepancies: Conflicting UniProt IDs (P81323 vs. Q58245) highlight annotation inconsistencies .

  3. Host Limitations: Mammalian cell expression (used in some protocols ) may introduce post-translational modifications irrelevant to archaeal systems.

Comparative Analysis with Related Proteins

ProteinFunctionHostKey Feature
MJ0835.1UncharacterizedE. coli/yeastHis-tagged, full-length (1–377 aa)
PAN (MJ1176)Proteasome-activating nucleotidaseE. coliATPase activity (V<sub>max</sub> = 5.8 μmol/min/mg)
MJ1311pd-Tagatose 3-epimerase-likeE. coliZinc-binding, dimeric structure

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0835.1; UPF0333 protein MJ0835.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0835.1
Target Protein Sequence
MNTMENKIIKSKKAQVSLEFSFLFLAILLASIITISHFLSQNFTKDDKVISDVENAAKTA VILANSGYNGINPNVTLIYGGISWSGNKKNIYIYISPKSYITPEIKNFIVSYIYNVTKIN QSEYNITVNP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0333 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii UPF0333 protein MJ0835.1?

The UPF0333 protein MJ0835.1 is a protein from the hyperthermophilic methanogenic archaeon Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440). This organism inhabits deep-sea hydrothermal vents and serves as an important model for studying early Earth metabolism and high-temperature bio-catalysis. The "UPF" designation indicates it belongs to the Uncharacterized Protein Family, meaning its precise function remains to be fully elucidated through experimental approaches. The protein is registered in the UniProt database with accession number P81323 .

What are the optimal storage conditions for recombinant MJ0835.1 protein?

The shelf life of recombinant MJ0835.1 protein depends on several factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. For liquid formulations, the recommended storage period is typically 6 months at -20°C/-80°C. Lyophilized forms demonstrate extended stability, with a shelf life of approximately 12 months at -20°C/-80°C. To maintain protein integrity, repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week before significant degradation occurs .

How does M. jannaschii's evolutionary significance impact research on MJ0835.1?

M. jannaschii performs a respiratory metabolism estimated to be approximately 3.5 billion years old and inhabits environments that mimic the conditions of early Earth. This archaeon has survived in inhospitable undersea environments with toxic compounds and near-boiling temperatures. The genetic system for M. jannaschii recently developed by researchers represents a significant breakthrough, allowing scientists to manipulate its genome to study proteins like MJ0835.1 in their evolutionary context. This provides a unique opportunity to investigate the protein's role in an organism that potentially harbors remnants of early metabolic pathways .

What reconstitution procedures are recommended for working with recombinant MJ0835.1?

Prior to opening the vial containing recombinant MJ0835.1, brief centrifugation is recommended to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard default. Following reconstitution, the solution should be aliquoted to minimize freeze-thaw cycles and stored at -20°C/-80°C for optimal stability. When working with the protein, maintaining consistent temperature conditions is critical for preserving its structural integrity .

How can researchers verify the purity and integrity of recombinant MJ0835.1?

The standard commercial preparation of recombinant MJ0335.1 typically demonstrates >85% purity as assessed by SDS-PAGE. Researchers should conduct their own quality control procedures to verify this purity level before experimental use. Common verification methods include:

  • SDS-PAGE with Coomassie or silver staining to assess purity

  • Western blot analysis using specific antibodies if available

  • Mass spectrometry to confirm protein identity and detect potential modifications

  • Size-exclusion chromatography to evaluate aggregation states

  • Activity assays (if function is known) to confirm biological activity

For proteins from extremophiles like M. jannaschii, additional stability testing at various temperatures may provide valuable information about functional integrity .

What expression systems are typically used for producing recombinant archaeal proteins like MJ0835.1?

  • E. coli systems with codon optimization: Modified for expressing archaeal proteins with different codon usage patterns

  • Archaeal expression hosts: For maintaining native folding and post-translational modifications

  • Cell-free protein synthesis: Particularly useful for proteins that might be toxic to host cells

  • In silico design approaches: Similar to the V(D)J recombination platform techniques that can be adapted for difficult-to-express proteins

Each system offers different advantages in terms of yield, proper folding, and post-translational modifications relevant to the protein's native structure and function.

How might the UPF0333 protein family relate to nonsense-mediated mRNA decay (NMD) factors?

While MJ0835.1 is designated as a UPF0333 family protein, it shares its UPF prefix with better-characterized eukaryotic proteins involved in nonsense-mediated mRNA decay (NMD). The UPF3 proteins in eukaryotes feature RNA-recognition motif-like domains (RRM-L) and NONA/paraspeckle-like domains (NOPS-L), which are essential for RNA/ribosome-binding and RNA-induced oligomerization. Although direct functional equivalence has not been established, investigating whether MJ0835.1 possesses similar structural domains could provide insights into potential RNA-binding properties or involvement in archaeal RNA processing pathways. Research approaches might include structural analysis, RNA-binding assays, and interaction studies with other cellular components .

What techniques can be used to study protein-protein interactions involving MJ0835.1?

Investigating protein-protein interactions for MJ0835.1 requires approaches that account for its thermophilic origin. Recommended techniques include:

  • Surface Plasmon Resonance (SPR): Can measure binding kinetics and affinities under varying temperature conditions, similar to methods used for studying UPF protein interactions

  • Pull-down assays: Using tagged recombinant MJ0835.1 to identify binding partners

  • Yeast two-hybrid screening: Modified for high-temperature proteins

  • Molecular dynamics simulations: Particularly valuable for thermostable proteins, allowing prediction of interactions at elevated temperatures

  • Structure-guided mutagenesis: Creating variants to test the contribution of specific residues to protein interactions

These approaches can help identify potential interaction partners and characterize the binding interfaces, providing insights into the protein's functional role in archaeal cellular processes .

How can the genetic system for M. jannaschii be utilized to study MJ0835.1 function in vivo?

The recently developed genetic system for M. jannaschii represents a powerful tool for studying MJ0835.1 in its native context. This breakthrough allows researchers to manipulate the organism's chromosome and investigate gene function directly. To study MJ0835.1, researchers could:

  • Create knockout strains by deleting the MJ0835.1 gene to observe phenotypic changes

  • Introduce mutations to specific domains of the protein to assess their functional importance

  • Tag the native protein with fluorescent markers to observe subcellular localization

  • Perform complementation studies with modified versions of the protein

  • Conduct comparative transcriptomics and proteomics between wild-type and modified strains

These approaches could reveal the protein's role in M. jannaschii's unique metabolism and adaptation to extreme environments, particularly its potential involvement in archaeal-specific processes that have been preserved from early Earth conditions .

How might structural characteristics of MJ0835.1 contribute to thermostability?

As a protein from a hyperthermophilic archaeon that thrives near deep-sea hydrothermal vents, MJ0835.1 likely exhibits remarkable thermostability. Advanced structural analyses could reveal adaptations such as:

  • Increased number of salt bridges and hydrogen bonds

  • Higher proportion of charged amino acids on the protein surface

  • Compact hydrophobic core with reduced cavity volume

  • Lower content of thermolabile amino acids (Asn, Gln, Cys, Met)

  • Potentially unique disulfide bond arrangements

Methodological approaches to investigate these features include X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, differential scanning calorimetry, and molecular dynamics simulations. Comparing structural features of MJ0835.1 with mesophilic homologs could provide insights into evolutionary adaptations to extreme environments and potentially inform protein engineering efforts .

What are the challenges in determining the function of uncharacterized proteins like MJ0835.1?

The "UPF" designation indicates MJ0835.1 belongs to an uncharacterized protein family, presenting several challenges for functional determination:

  • Limited homology: Few characterized homologs may exist in model organisms

  • Extreme native conditions: Standard functional assays may not replicate the high-temperature, high-pressure environment

  • Archaeal-specific biochemistry: May involve unique metabolic pathways not present in better-studied organisms

  • Potential multifunctionality: Could perform different functions under varying environmental conditions

Researchers can address these challenges through:

  • Computational approaches combining homology modeling and machine learning to predict function

  • Development of high-temperature, high-pressure assay systems

  • Comparative genomics across archaeal species to identify conserved genomic contexts

  • In vitro reconstitution of potential biochemical pathways

  • Integration of genomic, transcriptomic, proteomic, and metabolomic data to infer functional networks

How can MD simulations enhance our understanding of MJ0835.1 structure-function relationships?

Molecular dynamics (MD) simulations represent a powerful computational approach for studying proteins from extremophiles like M. jannaschii. For MJ0835.1, MD simulations could:

  • Model protein behavior at the high temperatures (near 85°C) found in its native environment

  • Predict conformational changes that might occur during function

  • Identify potential binding sites for substrates or interaction partners

  • Estimate the energetics of protein-protein and protein-ligand interactions

  • Evaluate the impact of mutations on protein stability and function

The implementation of such simulations could follow similar approaches to those used in the in silico V(D)J recombination platform, where MD simulations were employed to analyze trajectories and derive root mean squared deviation (RMSD) values. These values could then be correlated with experimental data to validate computational predictions, creating a robust framework for structure-function analyses of this archaeal protein .

How does MJ0835.1 compare to other UPF family proteins across domains of life?

Comparative analysis between archaeal UPF0333 proteins like MJ0835.1 and eukaryotic UPF proteins reveals important evolutionary relationships. While eukaryotic UPF3 proteins function in nonsense-mediated mRNA decay and contain specific structural motifs like RRM-L and NOPS-L domains, archaeal UPF0333 proteins may represent distant evolutionary relatives with potentially divergent functions. Researchers investigating these relationships should:

  • Perform detailed sequence alignments to identify conserved motifs

  • Construct phylogenetic trees to map evolutionary trajectories

  • Compare predicted secondary and tertiary structures

  • Identify potential functional sites through conservation analysis

  • Examine genomic context for insights into functional associations

This comparative approach may reveal whether archaeal UPF0333 proteins represent primitive versions of RNA surveillance machinery or have evolved for entirely different functions in archaeal cells .

What techniques can be employed to determine if MJ0835.1 binds RNA or participates in RNA processing?

Given the RNA-binding capabilities of some UPF family proteins, investigating whether MJ0835.1 interacts with RNA would provide valuable functional insights. Methodological approaches include:

  • RNA electrophoretic mobility shift assays (EMSA): Modified for high-temperature conditions

  • RNA immunoprecipitation: Using antibodies against recombinant MJ0835.1

  • CRISPR-based techniques: Leveraging the recently developed genetic system for M. jannaschii

  • Surface plasmon resonance: To measure RNA binding kinetics at varying temperatures

  • In vitro transcription-translation systems: To assess effects on RNA processing

These experiments should be designed to test binding across different RNA species (mRNA, tRNA, rRNA) and under conditions that mimic the native environment of M. jannaschii. Positive results would suggest potential involvement in archaeal RNA metabolism or regulation .

What is the relationship between MJ0835.1 and M. jannaschii's adaptation to extreme environments?

M. jannaschii thrives in deep-sea hydrothermal vents with near-boiling temperatures, high pressure, and potentially toxic compounds. Investigating MJ0835.1's role in this adaptation requires a multifaceted approach:

  • Expression analysis under varying stress conditions (temperature, pressure, chemical stressors)

  • Comparison of MJ0835.1 with homologs from mesophilic archaea

  • Assessment of protein stability and activity across environmental gradients

  • Potential involvement in stress response pathways

  • Investigation of protein-protein interaction networks under stress conditions

This research would not only illuminate the specific function of MJ0835.1 but could also provide broader insights into the molecular mechanisms underlying extremophile adaptation. The recently developed genetic system for M. jannaschii offers unprecedented opportunities to address these questions through targeted genetic manipulation .

What are common challenges when working with recombinant proteins from hyperthermophiles?

Researchers working with recombinant MJ0835.1 and similar proteins from hyperthermophilic organisms face several technical challenges:

  • Expression system compatibility: Standard expression systems may not properly fold proteins adapted to extreme conditions

  • Activity assessment: Ensuring proper folding and activity when the protein's function remains uncharacterized

  • Buffer conditions: Standard buffers may not mimic the ionic strength and pH of the native environment

  • Stability during purification: Proteins adapted to high temperatures may exhibit unexpected behavior at laboratory temperatures

  • Assay development: Standard assays may require modification for high-temperature conditions

Addressing these challenges requires careful optimization of expression systems, buffer compositions, and experimental conditions. Researchers should consider including positive controls with known thermostable proteins when developing new protocols .

How can researchers ensure proper folding of recombinant MJ0835.1?

Ensuring proper folding of recombinant MJ0835.1 is critical for functional studies. Recommended approaches include:

  • Expression temperature optimization: Testing various temperatures during protein expression

  • Chaperone co-expression: Including archaeal chaperones in the expression system

  • Denaturation-renaturation protocols: Controlled refolding under conditions mimicking the native environment

  • Circular dichroism spectroscopy: To assess secondary structure content

  • Limited proteolysis: To evaluate structural integrity

  • Thermal shift assays: To determine melting temperature and stability conditions

These methods can help ensure that recombinant MJ0835.1 maintains a native-like conformation, which is essential for reliable functional studies. For proteins like MJ0835.1 from extremophiles, traditional indicators of proper folding may need to be reconsidered within the context of their unusual native environments .

What are the key considerations for designing experiments with MJ0835.1 at high temperatures?

When designing experiments to study MJ0835.1 at temperatures reflecting its native environment (near 85°C), researchers should consider:

  • Equipment compatibility: Ensuring instruments can maintain stable high temperatures

  • Buffer stability: Using buffers resistant to degradation at high temperatures

  • Control proteins: Including well-characterized thermostable proteins as positive controls

  • Time considerations: Potentially shorter reaction times due to increased reaction rates

  • Sample evaporation: Implementing measures to prevent sample concentration changes

  • Data normalization: Developing appropriate controls for temperature-dependent phenomena

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.