Recombinant Methanocaldococcus jannaschii UPF0721 transmembrane protein MJ0441 (MJ0441)

Shipped with Ice Packs
In Stock

Description

Genomic and Functional Context

MJ0441 is encoded by the MJ0441 gene located on the main chromosome of M. jannaschii, an archaeon first sequenced in 1996 . Key genomic insights include:

  • Genome Position: Chromosome (1.66 Mb) .

  • Functional Annotation: Classified under the UPF0721 family, implicated in transmembrane transport .

  • Metabolic Role: Despite extensive annotation efforts, ~33% of M. jannaschii proteins, including MJ0441, remain uncharacterized .

Comparative membrane proteomics identified MJ0441 as a low-abundance transmembrane protein potentially involved in cell growth and redox regulation .

3.2. Functional Hypotheses

  • Transport Activity: MJ0441’s sequence homology to transporters supports its potential role in ion or metabolite transport .

  • Palmitoylation Site: A conserved cysteine residue suggests post-translational modification, as observed in related archaeal transporters .

3.3. Experimental Data

StudyKey Finding
Proteomic AnalysisMJ0441 was enriched in membrane fractions, suggesting localization to lipid-rich domains .
Cryo-EMRelated transmembrane proteins (e.g., TMH4C4) revealed 16-helix pore structures, informing MJ0441 modeling .
MutagenesisCharge alterations at pore entry sites (e.g., Glu44→Phe) reduced ion conductance in homologs .

Challenges and Future Directions

  • Functional Verification: No direct activity assays for MJ0441 are reported; future work may employ liposome flux assays or electrophysiology .

  • Biotechnological Potential: Engineered MJ0441 variants could serve as synthetic nanopores for sequencing or biosensing .

References (Integrated Citations)

  • Genome annotation and metabolic reconstruction:

  • Structural and functional insights:

  • Expression and purification protocols:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0441; Probable membrane transporter protein MJ0441
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0441
Target Protein Sequence
MVIKLEFEFLLLLPLLIIVGFIVGILGSLFGIGGGFLVAPILTFIFDYFGIPDGVKFAVG TSLFVVFINSIISIFRHAKIKNINWKASITIGIISLVFSYFSGFLVVNFIDSAILKKLFG IFLIANAIYMAKSHHIDKISDREDKLEPFILCGVITGFLSGLFGIGGGIVIIPILAMAKY PVKRAVAISVGVIPLTSIGGLISYLTANTEGYIYNIGYVSIPIALIMAIPIIYSSKLGIK INQKISPKHLRIMLSSILGVMGLFMLL
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0441

STRING: 243232.MJ_0441

Protein Families
4-toluene sulfonate uptake permease (TSUP) (TC 2.A.102) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the general structure and function of MJ0441 transmembrane protein?

MJ0441 is a transmembrane protein from the hyperthermophilic archaeon Methanocaldococcus jannaschii, classified under the UPF0721 protein family. As a transmembrane protein, it spans the cell membrane with regions exposed to both the intracellular and extracellular environments. While its precise function remains under investigation, structural analysis suggests roles in membrane integrity and potentially in protein folding quality control mechanisms similar to other archaeal membrane proteins. Experimental approaches to study its structure typically include circular dichroism spectroscopy, NMR studies in membrane mimetics, and crystallography attempts with detergent-solubilized protein.

What expression systems are most suitable for recombinant MJ0441 production?

For recombinant production of archaeal transmembrane proteins like MJ0441, E. coli remains the most commonly utilized expression system due to its versatility and established protocols. Similar to the recombinant ApoE4 produced in E. coli described in the literature, MJ0441 can be expressed using bacterial systems with appropriate modifications . The key considerations include:

Expression SystemAdvantagesChallengesYield Optimization Strategies
E. coliRapid growth, cost-effective, well-established protocolsPotential misfolding of archaeal proteins, inclusion body formationUse of specialized strains (C41, C43), lower induction temperatures (16-22°C), co-expression with archaeal chaperones
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesHigher cost, lower yieldSupplementation with archaeal lipids, optimization of redox conditions
Archaeal hostsNative folding environment, appropriate post-translational modificationsSlower growth, more technically demandingCulture at elevated temperatures (65-85°C), specialized media formulations

How should samples of recombinant MJ0441 be properly stored after purification?

Proper storage of purified recombinant MJ0441 is critical for maintaining protein integrity. Based on practices for similar recombinant proteins, MJ0441 should be stored in a stabilizing buffer containing appropriate detergents or reconstituted into lipid nanodiscs or liposomes. For short-term storage (1-2 weeks), the protein can be kept at 4°C in appropriate buffer conditions. For longer-term storage, lyophilization or flash-freezing in liquid nitrogen followed by storage at -80°C is recommended . Addition of glycerol (10-15%) can help prevent freeze-thaw damage. When handling the protein, it's advisable to avoid repeated freeze-thaw cycles by preparing multiple single-use aliquots.

How should a researcher design experiments to characterize MJ0441 function?

When designing experiments to characterize MJ0441 function, researchers should follow a systematic approach based on established experimental design principles. Begin by defining clear research questions and formulating specific, testable hypotheses about MJ0441's functional role . The experimental design should include:

  • Variable identification: Define independent variables (such as temperature, pH, salt concentration) and dependent variables (protein activity, binding capacity, structural changes).

  • Control implementation: Include both positive controls (known functional archaeal transmembrane proteins) and negative controls (denatured protein, buffer-only conditions).

  • Treatment design: Create experimental conditions that test the protein under physiologically relevant conditions for thermophilic archaea, including elevated temperatures (70-85°C) and high salt concentrations.

  • Randomization and replication: Ensure statistical validity through proper randomization of samples and adequate biological and technical replicates (minimum n=3).

For functional characterization, consider combining multiple techniques:

  • Liposome-based assays to test transport activity

  • Binding assays with potential interacting partners

  • Structural studies under varying conditions

  • In vitro reconstitution systems with archaeal lipids

What are the best practices for optimizing MJ0441 solubilization and purification protocols?

Optimizing solubilization and purification of transmembrane proteins like MJ0441 requires careful consideration of detergent selection and buffer conditions. The following methodology provides a systematic approach:

Step 1: Detergent screening
Test a panel of detergents varying in micelle size, charge, and harshness:

  • Mild detergents: DDM, LMNG, digitonin

  • Intermediate detergents: DM, UDM

  • Harsh detergents: OG, LDAO

Step 2: Buffer optimization
Evaluate different buffer compositions:

ParameterRange to TestConsiderations
pH6.0-8.5Test at 0.5 pH increments
Salt concentration100-500 mMConsider KCl, NaCl
Glycerol0-20%Aids stability
Stabilizing agentsVariousTCEP, DTT, specific lipids

Step 3: Purification strategy
Implement a multi-step purification process:

  • Initial capture using affinity chromatography (His-tag)

  • Size exclusion chromatography for oligomeric state analysis

  • Optional ion exchange step for higher purity

Step 4: Quality assessment
Validate protein quality through:

  • SDS-PAGE (>90% purity)

  • Western blotting

  • Mass spectrometry

  • Thermostability assays

  • Circular dichroism to confirm secondary structure

How can researchers effectively design control experiments when studying MJ0441?

  • Negative controls: Include samples without MJ0441 protein but with all other components to account for background effects. For functional assays, use denatured MJ0441 to demonstrate specificity.

  • Positive controls: Incorporate well-characterized transmembrane proteins with known functions for comparison.

  • Vehicle controls: When testing effects of compounds on MJ0441, include vehicle-only conditions (e.g., buffer with equivalent amounts of DMSO if compounds are dissolved in DMSO).

  • Concentration gradients: Test MJ0441 at multiple concentrations to establish dose-response relationships.

  • Environmental controls: For thermostable archaeal proteins like MJ0441, include controls at different temperatures to account for temperature-dependent effects.

What strategies can be employed to study MJ0441 protein-protein interactions in membrane environments?

Studying protein-protein interactions of transmembrane proteins like MJ0441 in membrane environments requires specialized approaches that maintain the native-like lipid environment while enabling detection of interaction partners. Advanced researchers can employ the following methodologies:

  • Crosslinking-based approaches:

    • Photo-reactive amino acid incorporation at specific sites in MJ0441

    • Chemical crosslinking with membrane-permeable reagents

    • Analysis of crosslinked products via mass spectrometry

  • Proximity labeling methods:

    • APEX2 or BioID fusion constructs with MJ0441

    • In vivo labeling followed by streptavidin pulldown

    • Mass spectrometry identification of proximal proteins

  • Reconstituted systems:

    • Nanodiscs containing MJ0441 and potential interaction partners

    • Liposome-based assays with fluorescently labeled proteins

    • Surface plasmon resonance with immobilized MJ0441

  • Advanced microscopy techniques:

    • FRET-based interaction studies in reconstituted systems

    • Single-molecule tracking in membrane mimetics

    • Super-resolution microscopy of labeled MJ0441

The experimental design should include appropriate controls to distinguish specific from non-specific interactions . Data analysis should incorporate statistical evaluation of interaction significance and consideration of potential artifacts introduced by the detection method.

How can researchers address contradictory data when studying MJ0441 folding mechanisms?

When faced with contradictory data regarding MJ0441 folding mechanisms, researchers should implement a systematic approach to resolve discrepancies:

  • Thorough data examination: Carefully analyze all datasets to identify specific points of contradiction. Examine raw data for anomalies or patterns that might explain differences .

  • Methodology reassessment: Compare experimental methods used across contradictory studies:

    • Protein preparation differences (tags, purification methods)

    • Buffer composition variations

    • Detergent/lipid environment differences

    • Measurement techniques and conditions

  • Hypothesis refinement: Consider whether contradictions suggest multiple folding pathways or condition-dependent mechanisms rather than experimental error .

  • Targeted experiments: Design experiments specifically to address contradictions:

ApproachImplementationExpected Outcome
Varied conditionsTest folding under multiple temperatures, pH values, and salt concentrationsIdentify condition-dependent folding mechanisms
Time-resolved measurementsMonitor folding at multiple time points using spectroscopyDetect intermediate states that might explain contradictions
Single-molecule techniquesApply FRET or force spectroscopy to individual moleculesReveal heterogeneity in folding pathways
Computational modelingSimulate folding under different conditionsProvide theoretical framework for reconciling contradictions
  • Integration of findings: Develop a comprehensive model that accommodates seemingly contradictory data, potentially revealing more complex mechanisms than initially hypothesized .

What techniques are most effective for studying the thermostability of MJ0441 given its archaeal origin?

As a protein from the hyperthermophilic archaeon Methanocaldococcus jannaschii, MJ0441 exhibits unusual thermostability that requires specialized techniques for proper characterization:

  • Differential Scanning Calorimetry (DSC): This technique provides direct measurement of thermal transitions and can be performed at elevated temperatures (up to 130°C) required for thermophilic proteins. Key parameters to measure include:

    • Melting temperature (Tm)

    • Enthalpy of unfolding (ΔH)

    • Heat capacity change (ΔCp)

  • Circular Dichroism (CD) with temperature ramping: Monitor secondary structure changes across a wide temperature range (25-110°C) with specialized equipment for high-temperature measurements.

  • Intrinsic fluorescence spectroscopy: Track changes in tryptophan/tyrosine fluorescence as indicators of tertiary structure stability at elevated temperatures.

  • Activity assays under extreme conditions: Design functional assays that can be performed at physiologically relevant high temperatures to assess structure-function relationships.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Apply this technique at varied temperatures to identify regions of the protein with differential stability.

Data analysis should include:

  • Comparison of stability parameters between MJ0441 and mesophilic homologs

  • Correlation of thermostability with structural features

  • Assessment of the role of specific amino acids in maintaining stability

How should researchers analyze data that contradicts initial hypotheses about MJ0441 function?

When data contradicts initial hypotheses about MJ0441 function, researchers should adopt a systematic approach to analysis rather than immediately discarding the data or forcing it to fit preconceived notions:

  • Verify experimental validity: Before interpreting contradictory results, ensure experimental integrity through:

    • Examination of positive and negative controls

    • Verification of protein quality and activity

    • Review of methodological consistency

    • Statistical analysis of reproducibility

  • Consider alternative explanations: Explore multiple interpretations of the unexpected results:

    • Could MJ0441 have multiple, context-dependent functions?

    • Might post-translational modifications alter function?

    • Could interaction partners present/absent in your system affect function?

    • Is the observed function an evolutionary adaptation specific to thermophilic environments?

  • Design follow-up experiments: Target specific aspects of the contradiction:

Question TypeExample QuestionExperimental Approach
ValidationIs the contradictory result reproducible?Repeat with modified conditions
MechanismWhat factors influence the unexpected function?Systematic variation of experimental parameters
IntegrationHow does the new function relate to known properties?Combine functional assays with structural analysis
  • Revise the hypothesis: Develop a refined hypothesis that accommodates the new data, potentially revealing novel aspects of MJ0441 biology .

  • Consider broader implications: Evaluate how contradictory findings might relate to current understanding of archaeal membrane proteins generally.

What statistical approaches are most appropriate for analyzing MJ0441 structure-function relationship data?

Statistical analysis of structure-function relationships for MJ0441 requires approaches that can handle complex, multidimensional data while accounting for experimental variation inherent in membrane protein research:

  • Correlation analyses:

    • Pearson or Spearman correlation coefficients to identify relationships between structural parameters and functional outputs

    • Partial correlation analysis to control for confounding variables (temperature, pH, lipid composition)

  • Multivariate approaches:

    • Principal Component Analysis (PCA) to identify key variables driving functional differences

    • Hierarchical clustering to identify structural motifs associated with specific functions

    • Multiple regression models to predict functional outcomes from structural parameters

  • Statistical validation:

    • Cross-validation techniques to ensure model robustness

    • Permutation tests to establish significance thresholds

    • Bootstrap methods to estimate confidence intervals

  • Specialized approaches for thermophilic proteins:

    • Temperature-dependence modeling using Arrhenius or Eyring equations

    • Comparative statistical analysis against mesophilic homologs

Example statistical workflow:

Analysis StageTechniquePurpose
Data preprocessingNormalization, outlier detectionEnsure data quality
Exploratory analysisPCA, correlation matricesIdentify patterns and relationships
Hypothesis testingANOVA, regression analysisTest specific structure-function relationships
Model buildingMultiple regression, machine learningDevelop predictive models
ValidationCross-validation, bootstrappingEnsure model reliability

When reporting results, include effect sizes alongside p-values and clearly state all statistical assumptions and limitations .

How can researchers effectively distinguish between experimental artifacts and genuine findings when studying MJ0441?

Distinguishing between experimental artifacts and genuine findings is particularly challenging when working with archaeal transmembrane proteins like MJ0441 due to their unusual stability properties and specialized handling requirements. Researchers should implement a comprehensive verification strategy:

  • Systematic controls implementation:

    • Include detergent-only controls to identify detergent effects

    • Test multiple purification batches to ensure consistency

    • Incorporate known archaeal membrane proteins as reference standards

    • Use denatured MJ0441 samples as negative controls

  • Multi-technique verification:

    • Confirm findings using orthogonal methods (e.g., if using fluorescence, verify with circular dichroism)

    • Compare results across different membrane mimetics (detergent micelles, nanodiscs, liposomes)

    • Validate functional assays using both in vitro and in vivo approaches when possible

  • Artifact identification strategies:

    • Test for detergent interference in assays

    • Verify protein stability under experimental conditions

    • Assess aggregation state using dynamic light scattering

    • Check for batch-to-batch variation

  • Critical data analysis:

    • Apply statistical tests to distinguish signal from noise

    • Consider the magnitude of effects relative to experimental variation

    • Look for dose-dependency and saturation effects as indicators of specific interactions

    • Assess whether effects follow biologically plausible mechanisms

  • Replication with variations:

    • Repeat key experiments with altered conditions

    • Test the effect of tag position or removal

    • Vary protein concentration ranges

    • Modify buffer conditions systematically

By implementing these verification strategies, researchers can build confidence in genuine findings while identifying and eliminating artifacts .

What are the most effective approaches for troubleshooting low yield or insolubility issues with recombinant MJ0441?

Low yield and insolubility are common challenges when working with archaeal transmembrane proteins like MJ0441. A systematic troubleshooting approach includes:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Vary induction conditions (IPTG concentration, temperature, duration)

    • Evaluate different media formulations

    • Consider codon optimization of the MJ0441 gene

  • Solubilization strategy refinement:

    • Screen detergent panel (from harsh to mild)

    • Test mixed detergent systems

    • Incorporate stabilizing lipids during solubilization

    • Evaluate pH and salt concentration effects

  • Fusion tag strategies:

    • Test N-terminal vs. C-terminal tag placement

    • Evaluate different fusion partners (MBP, SUMO, TrxA)

    • Consider dual tagging approaches

    • Optimize tag cleavage conditions

  • Alternative approaches:

    • Cell-free expression directly into liposomes

    • Inclusion body recovery and refolding

    • Split protein complementation

Systematic tracking of optimization results:

Parameter ModifiedCondition TestedYield (mg/L)Solubility (%)Purity (%)Activity (%)
E. coli strainBL21(DE3)XXXX
C41(DE3)XXXX
RosettaXXXX
Induction temperature37°CXXXX
25°CXXXX
18°CXXXX
DetergentDDMXXXX
LMNGXXXX
DigitoninXXXX

Each optimization step should be evaluated for its effect on yield, solubility, purity, and functional activity to determine the optimal conditions .

How should researchers approach unexpected thermal stability profiles of MJ0441?

When researchers encounter unexpected thermal stability profiles for MJ0441, a methodical investigation can help resolve discrepancies and provide valuable insights:

  • Validate measurement techniques:

    • Calibrate temperature sensors for high-temperature measurements

    • Use thermostable standards to verify equipment performance

    • Compare results across different techniques (CD, DSC, fluorescence)

    • Ensure adequate equilibration time at each temperature

  • Investigate buffer and environmental effects:

    • Test stability in buffers mimicking archaeal cytoplasm

    • Evaluate the effect of specific ions (K+, Mg2+, etc.)

    • Assess the impact of pH on thermal stability

    • Examine how detergent/lipid environment affects stability

  • Consider protein modification status:

    • Verify protein integrity by mass spectrometry

    • Check for oxidation of sensitive residues

    • Assess oligomeric state at different temperatures

    • Evaluate the effect of potential ligands or binding partners

  • Advanced approaches for thermophilic proteins:

    • Implement high-pressure thermal stability assays

    • Perform molecular dynamics simulations at elevated temperatures

    • Use hydrogen-deuterium exchange at various temperatures

    • Compare with homologous proteins from organisms with different optimal growth temperatures

When analyzing unexpected thermal stability profiles, researchers should consider that:

  • MJ0441 may have different stability domains with distinct melting transitions

  • The protein might undergo reversible unfolding at certain temperatures

  • Membrane environment significantly impacts thermal stability

  • Archaeal proteins often show unusual stability mechanisms compared to bacterial or eukaryotic counterparts

What strategies can researchers employ when MJ0441 exhibits unexpected interactions with membrane mimetics?

When MJ0441 displays unexpected interactions with membrane mimetics, researchers should employ a structured approach to investigate and resolve these issues:

  • Characterize the unexpected interaction:

    • Quantify binding affinities to different lipids

    • Assess aggregation state in various mimetic systems

    • Determine protein orientation using accessibility assays

    • Evaluate structural changes using spectroscopic methods

  • Systematic variation of membrane mimetics:

    • Test different detergent types and concentrations

    • Evaluate various lipid compositions, including archaeal lipids

    • Compare behavior in nanodiscs vs. liposomes vs. bicelles

    • Assess the impact of membrane curvature and thickness

  • Investigation of protein factors:

    • Analyze the role of specific transmembrane segments

    • Evaluate the contribution of charged or hydrophobic residues

    • Test the effect of oligomerization on membrane interactions

    • Consider post-translational modifications

  • Advanced biophysical analysis:

    • Neutron reflectometry to determine insertion depth

    • Solid-state NMR to assess protein-lipid interactions

    • Molecular dynamics simulations with various membrane models

    • EPR spectroscopy with site-directed spin labeling

Researchers should document all variables systematically:

Membrane SystemCompositionProtein:Lipid RatioObservationPotential Mechanism
Detergent micellesDDM, 2× CMC1:100AggregationMicelle disruption
NanodiscsPOPC/POPG (3:1)1:150Stable insertionCompatible hydrophobic thickness
LiposomesArchaeal lipid extract1:500Unusual orientationNatural lipid preference

By systematically investigating these variables, researchers can determine whether unexpected interactions represent artifacts or previously uncharacterized biological properties of MJ0441 .

What are promising strategies for investigating potential interactions between MJ0441 and other archaeal membrane proteins?

Investigating interactions between MJ0441 and other archaeal membrane proteins presents unique challenges due to their thermophilic nature and specialized membrane environment. Researchers should consider these promising approaches:

  • Co-evolution analysis:

    • Apply computational methods to identify proteins with correlated evolutionary patterns

    • Use sequence-based approaches to predict potential interaction partners

    • Analyze genomic context and operonic organization in archaeal genomes

  • Archaeal-specific interactome mapping:

    • Develop high-temperature compatible protein complementation assays

    • Adapt APEX2 proximity labeling for thermophilic conditions

    • Establish archaeal two-hybrid systems for membrane protein interactions

  • Reconstitution approaches:

    • Co-reconstitute MJ0441 with candidate partners in archaeal lipid systems

    • Develop functional assays that can detect coupled activities

    • Use FRET-based approaches with thermostable fluorescent proteins

  • Structural biology integration:

    • Apply cryo-EM to visualize potential complexes

    • Develop crosslinking mass spectrometry approaches for thermophilic proteins

    • Use solid-state NMR to detect interactions in membrane environments

  • In vivo validation in model archaeal systems:

    • Establish genetic manipulation systems in thermophilic archaea

    • Develop archaeal-specific protein tagging approaches

    • Create conditional depletion systems to assess functional relationships

TechniqueTemperature RangeAdvantagesLimitationsAdaptations for Thermophiles
Crosslinking MS25-95°CSite-specific informationChemical stability issuesThermostable crosslinkers
Co-IP4-25°CDirect interaction evidenceRequires antibodiesPerform lysis at lower temperatures
Proximity labeling25-85°CIn vivo contextEnzyme thermostabilityEngineered thermostable APEX variants
FRET25-90°CReal-time dynamicsFluorophore stabilityThermostable fluorescent proteins

These approaches should be implemented with appropriate controls and validation strategies to ensure reliable identification of genuine interaction partners .

How might researchers design experiments to elucidate the potential role of MJ0441 in extremophile adaptation?

To investigate MJ0441's potential role in extremophile adaptation, researchers should design experiments that specifically address the protein's function under extreme conditions characteristic of Methanocaldococcus jannaschii's native environment:

  • Comparative genomics and evolution approaches:

    • Compare MJ0441 sequences across archaea from diverse thermal environments

    • Identify signatures of positive selection in thermophilic lineages

    • Reconstruct ancestral sequences to trace evolutionary adaptations

  • Structure-function analysis under extreme conditions:

    • Characterize MJ0441 stability and function across temperature gradients (20-110°C)

    • Evaluate performance under high pressure (up to 200 MPa)

    • Assess stability in high salt concentrations and extreme pH

  • Membrane adaptation studies:

    • Investigate MJ0441's interaction with archaeal-specific lipids

    • Compare behavior in rigid vs. fluid membrane environments

    • Evaluate the protein's role in maintaining membrane integrity at high temperatures

  • Heterologous expression studies:

    • Express MJ0441 in mesophilic hosts and assess stress resistance

    • Create chimeric proteins with domains from mesophilic homologs

    • Evaluate complementation ability in deletion mutants

  • Physiological role assessment:

    • Develop gene deletion or silencing approaches in thermophilic archaea

    • Monitor changes in stress response under MJ0441 depletion

    • Identify condition-specific phenotypes (temperature, pressure, pH)

Experimental design should include appropriate controls and statistical approaches to distinguish adaptive features from experimental artifacts :

Experimental ApproachControl ConditionsExtreme ConditionsParameters MeasuredExpected Outcomes if Adaptive
Thermal stability25°C85°C, 100°CTm, unfolding kineticsHigher Tm, slower unfolding
Pressure resistanceAtmospheric50 MPa, 100 MPaActivity, structural integrityMaintained function under pressure
Membrane dynamicsBacterial lipidsArchaeal lipidsFluidity, permeabilityStabilization of archaeal membranes

What novel methodological approaches might advance our understanding of MJ0441 function and regulation?

Advancing our understanding of MJ0441 function and regulation may require innovative methodological approaches that address the unique challenges of studying archaeal membrane proteins from extremophiles:

  • Single-molecule approaches adapted for thermophiles:

    • Develop high-temperature compatible microfluidic systems

    • Apply force spectroscopy at elevated temperatures

    • Implement single-molecule FRET with thermostable fluorophores

    • Adapt nanopore technology for functional analysis

  • Archaeal-specific genetic tools:

    • Establish CRISPR-Cas9 systems functional in thermophilic archaea

    • Develop inducible expression systems for controlled expression

    • Create reporter systems stable at high temperatures

    • Design archaeal-specific protein degradation systems

  • Advanced structural methods:

    • Apply time-resolved cryo-EM to capture conformational changes

    • Develop solid-state NMR approaches optimized for archaeal membrane proteins

    • Use neutron scattering with deuterium labeling for membrane positioning

    • Implement integrative structural biology approaches combining multiple data types

  • Computational methods development:

    • Design molecular dynamics force fields optimized for thermophilic proteins

    • Create machine learning models to predict extremophile protein behavior

    • Develop specialized docking algorithms for membrane protein interactions

    • Implement network analysis tools for archaeal protein systems

  • Novel reconstitution systems:

    • Develop archaeal cell-derived vesicles for functional studies

    • Create hybrid vesicles with controlled lipid composition

    • Implement droplet interface bilayers functional at high temperatures

    • Design microfluidic organ-on-chip models for thermophiles

Each of these methodological innovations should be systematically validated and benchmarked against established techniques to ensure reliability and reproducibility :

Innovative MethodConventional ApproachAdvantage for MJ0441 ResearchTechnical ChallengesValidation Strategy
High-temp microfluidicsBulk assaysSingle-molecule resolutionMaterial thermal stabilityComparison with bulk measurements
Archaeal CRISPRHeterologous expressionNative contextDelivery to thermophilesValidate editing efficiency
Time-resolved cryo-EMStatic structural modelsConformational dynamicsSample vitrificationCorrelation with functional states
Archaeal lipid nanodiscsDetergent micellesNative-like environmentLipid synthesis/isolationFunctional comparison studies

By developing and applying these innovative approaches, researchers can overcome current technical limitations and gain new insights into MJ0441 function, regulation, and role in extremophile adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.