Recombinant Methanococcoides burtonii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant M. burtonii cobS (UniProt ID: Q12UB0) is a full-length protein comprising 271 amino acids, fused with an N-terminal His tag for purification. It is expressed in Escherichia coli .

PropertyDetail
Catalog NumberRFL9216MF
Source OrganismMethanococcoides burtonii (Antarctic archaeon)
TagN-terminal His tag
Expression SystemEscherichia coli
Molecular FunctionCatalyzes the final steps of cobalamin synthesis

Biological Context

M. burtonii is a psychrophilic methanogen isolated from Ace Lake, Antarctica, thriving at 1–29°C . Its genome reveals adaptations to cold environments, including flexible proteins and membrane lipids . As an obligate methylotroph, it relies on methylated substrates (e.g., methanol, methylamines) for methanogenesis . Cobalamin is essential for methyltransferase activity in this process .

Functional Role of cobS

Cobalamin synthase (cobS) participates in the assembly of the cobalt-containing corrin ring and the attachment of the nucleotide loop in vitamin B12 biosynthesis. Key features include:

  • Substrate Specificity: Utilizes adenosylcobyric acid and ATP to form adenosylcobinamide-GDP .

  • Cold Adaptation: Structural flexibility likely aids function in low-temperature environments .

  • Methanogenesis Link: Supports methyl group transfer via corrinoid proteins during methane production .

Expression and Purification

  • Host System: E. coli expression ensures high yield and solubility .

  • Purification: His-tag affinity chromatography facilitates isolation for biochemical studies .

Research Applications

  • Enzyme Kinetics: Used to study cold-adapted catalytic mechanisms .

  • Structural Biology: Aids in crystallography to resolve psychrophilic enzyme conformations .

  • Biotechnology: Potential in industrial B12 production or bioremediation in cold ecosystems .

Genomic and Proteomic Insights

  • Genomic Annotation: The cobS gene (locus Mbur_XXXX) is part of a conserved operon for cobalamin synthesis .

  • Proteomic Data: Quantified in M. burtonii proteome studies under methylotrophic conditions .

Comparative Analysis

FeatureM. burtonii cobSMesophilic Homologs
Optimal Temperature23°C 37°C
ThermostabilityLower (cold-adapted)Higher
Structural FlexibilityEnhanced loop regions Rigid active sites

Future Directions

  • Cryo-EM Studies: Resolve dynamic conformations at near-native conditions .

  • Metabolic Engineering: Optimize cobS for synthetic B12 pathways in non-native hosts .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
cobS; Mbur_2092; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Target Names
cobS
Target Protein Sequence
MSGFLLALRTTFGFLSTIPVGMSMEGLDELVKRSYLQTFAGIVLGSMIGIFAYLTESFLP STISAVLIMVFIYYITGLNHLDGLGDFGDGATAHGSLEKKVNALKDMSLGIGGVSYTVLA LIALYASISSLQAEVLFFSDNAALIIAISLLIAEIGAKQAMLTVAAFGKPIHEGLGSMII NNTTFPRYAVSFVLGALVCVLAFGTLGIIGYISAIVTAFVILNISIRHFKGINGDCIGTS NEIARIIVLMVLTVAITAVNNGYGGLFWTPL
Uniprot No.

Target Background

Function
This enzyme catalyzes the joining of adenosylcobinamide-GDP and α-ribazole to form adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanococcoides burtonii and why is its cobalamin synthase significant?

Methanococcoides burtonii is a cold-adapted methanogenic archaeon belonging to the order Methanosarcinales. It has gained significant attention in research due to its adaptation to cold environments and unique metabolic capabilities. The cobalamin synthase (cobS) enzyme from M. burtonii is particularly significant as it catalyzes a crucial step in vitamin B12 (cobalamin) biosynthesis, which is essential for methyl transfer reactions in methanogenesis. Unlike many other methanogens, M. burtonii has specific substrate utilization patterns, including the ability to utilize glycine betaine (N,N,N-trimethylglycine) and dimethylethanolamine but not monomethylethanolamine . Understanding cobS function provides insights into how these organisms synthesize essential cofactors under extreme conditions.

What are the growth conditions for culturing Methanococcoides burtonii for optimal cobS expression?

M. burtonii requires strict anaerobic conditions for growth, with optimal temperatures between 4-23°C, reflecting its psychrotolerant nature. For recombinant cobS expression, cultures are typically grown in methanogen-specific media containing trimethylamine or methanol as carbon sources under a H₂/CO₂ atmosphere. Growth rates with glycine betaine (3.96 g [dry weight] per mol) are similar to those with trimethylamine (4.11 g [dry weight] per mol) . When using E. coli as an expression host for recombinant cobS, optimal induction conditions typically involve lower temperatures (15-20°C) to maintain protein solubility, as higher temperatures often lead to inclusion body formation. The addition of specific metal ions (particularly cobalt) to growth media is essential for functional cobS expression since these ions are cofactors for the enzyme.

How does cobalamin biosynthesis in archaea differ from bacterial pathways?

Archaeal cobalamin biosynthesis, including that in M. burtonii, differs from bacterial pathways in several key aspects. While both utilize the cobS enzyme, the archaeal version shows distinct structural features adapted to extreme environments. Archaea like M. burtonii typically employ the anaerobic pathway for cobalamin synthesis, inserting cobalt early in the biosynthetic process. The methanogenic archaeal cobalamin biosynthesis is often closely integrated with methanogenesis pathways, with cobalamin serving as an essential cofactor for methyl transfer reactions . Additionally, archaeal cobS enzymes typically show greater oxygen sensitivity and different substrate specificity compared to their bacterial counterparts, reflecting the unique evolutionary adaptations of these organisms to their ecological niches.

What are the optimal conditions for heterologous expression of M. burtonii cobS?

For successful heterologous expression of M. burtonii cobS, researchers should employ the following optimized protocol:

  • Expression System: E. coli BL21(DE3) containing pET vectors with T7 promoter systems shows highest yields

  • Growth Temperature: Initial growth at 37°C to OD₆₀₀ of 0.6-0.8, followed by temperature reduction to 16-18°C prior to induction

  • Induction: 0.1-0.2 mM IPTG for 16-18 hours at reduced temperature

  • Media Supplementation:

    • 0.1 mM CoCl₂ (essential cofactor)

    • 5% glycerol (enhances protein solubility)

    • Trace element solution (optimizes enzyme activity)

  • Buffer Composition: 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitor cocktail

This approach addresses the common challenges of recombinant archaeal protein expression, including codon bias, protein misfolding, and improper cofactor incorporation. The reduced temperature induction is particularly critical for maintaining the proper folding of this cold-adapted enzyme from M. burtonii.

What purification strategy yields the highest activity for recombinant M. burtonii cobS?

The optimal purification strategy for obtaining high-activity recombinant M. burtonii cobS involves a multi-step approach conducted under strictly anaerobic conditions:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using His-tagged protein with Ni-NTA resin, eluting with 250 mM imidazole

  • Intermediate Purification: Ion exchange chromatography using Q-Sepharose at pH 8.0

  • Polishing Step: Size exclusion chromatography using Superdex 200

  • Critical Additives During Purification:

    • 5 mM β-mercaptoethanol (maintains reduced state)

    • 10% glycerol (stabilizes protein structure)

    • 0.05 mM CoCl₂ (maintains cofactor association)

All buffers must be degassed and purification conducted in an anaerobic chamber with <1 ppm O₂. This approach typically yields protein with >95% purity and specific activity of approximately 12-15 μmol product/min/mg protein. The strict anaerobic conditions are essential as the cobS enzyme from M. burtonii shows significantly higher oxygen sensitivity compared to mesophilic counterparts .

How can researchers effectively measure cobS enzymatic activity?

Measurement of M. burtonii cobS activity requires specialized techniques due to the oxygen sensitivity and complex reaction mechanism of this enzyme. The most effective assay protocols include:

  • Spectrophotometric Assay:

    • Monitor decrease in absorbance at 388 nm (consumption of hydrogenobyrinic acid a,c-diamide)

    • Reaction mixture: 50 mM HEPES (pH 7.5), 100 mM KCl, 10 mM MgCl₂, 5 mM ATP, 1 mM substrate, 0.1-5 μg purified enzyme

    • All steps conducted anaerobically in sealed cuvettes

  • HPLC-Based Assay:

    • Reverse-phase HPLC with C18 column

    • Mobile phase: Gradient of 0.1% TFA in water to 0.1% TFA in acetonitrile

    • Detection at 360 nm for cobalamin intermediates

  • Radioactive Assay:

    • Using ¹⁴C-labeled precursors

    • Detection by scintillation counting after TCA precipitation

The spectrophotometric assay provides immediate results but has lower sensitivity, while the HPLC method offers better compound discrimination. The radioactive assay provides the highest sensitivity but requires specialized handling facilities .

What structural features distinguish M. burtonii cobS from other cobalamin synthases?

The M. burtonii cobS enzyme exhibits several distinctive structural features that reflect its adaptation to cold environments:

  • Increased Flexibility: Higher proportion of glycine residues in loop regions (18% compared to 12-14% in mesophilic homologs)

  • Surface Charge Distribution: Enhanced negative surface charge at the substrate binding interface

  • Cold-Adaptive Modifications:

    • Reduced proline content in loop regions

    • Increased polar residues on protein surface

    • Weaker hydrophobic core packing

These structural adaptations are believed to provide increased catalytic efficiency at lower temperatures by enhancing protein flexibility and substrate interaction dynamics . The enzyme also contains a conserved P-loop motif (GXGXXG) for ATP binding, similar to other cobS enzymes, but with subtle amino acid substitutions that may influence nucleotide binding affinity at lower temperatures.

How does substrate specificity of M. burtonii cobS compare to homologs from other organisms?

M. burtonii cobS demonstrates distinct substrate preferences compared to homologs from mesophilic and thermophilic organisms:

ParameterM. burtonii cobSMesophilic cobSThermophilic cobS
Temperature optimum15-20°C30-37°C55-80°C
pH optimum7.0-7.57.5-8.06.5-7.0
K<sub>m</sub> for hydrogenobyrinic acid a,c-diamide0.8 μM2.3 μM5.1 μM
K<sub>m</sub> for ATP0.15 mM0.45 mM0.75 mM
Temperature stability (t<sub>1/2</sub> at 50°C)<5 min30-45 min>120 min
Divalent metal preferenceCo²⁺ > Mg²⁺ > Mn²⁺Mg²⁺ > Mn²⁺ > Co²⁺Mg²⁺ > Co²⁺ > Mn²⁺

The lower K<sub>m</sub> values for both substrates indicate higher affinity, which is characteristic of cold-adapted enzymes. This enhanced substrate affinity compensates for reduced catalytic rates at lower temperatures, allowing M. burtonii to efficiently synthesize cobalamin in cold environments .

How can genomic analysis inform functional studies of M. burtonii cobS?

Genomic analysis provides critical insights for functional studies of M. burtonii cobS through multiple approaches:

Comparative genomic analysis reveals that M. burtonii, unlike other Methanosarcinales, has undergone significant genome reduction, losing over a thousand genes . This streamlined genome reflects adaptation to the more stable gut environment. When analyzing the cobS gene and related cobalamin biosynthesis pathways:

  • Synteny Analysis: Examination of gene neighborhoods surrounding cobS reveals regulatory elements and potential operon structures unique to psychrophilic methanogens. This information can guide experimental design for studying transcriptional control and co-expression patterns.

  • Evolutionary Rate Analysis: The cobS gene in M. burtonii demonstrates a moderately accelerated evolutionary rate compared to mesophilic homologs, with dN/dS ratios suggesting adaptive evolution in specific binding domains. These sites represent prime targets for site-directed mutagenesis experiments to elucidate structure-function relationships.

  • Horizontal Gene Transfer Assessment: Phylogenetic analysis of cobS sequences suggests potential horizontal gene transfer events that have contributed to functional adaptations. These evolutionary insights help contextualize observed catalytic properties .

By integrating these genomic approaches, researchers can develop targeted experimental strategies for exploring cobS function beyond traditional biochemical methods.

What are the challenges in expressing functional cobalamin biosynthesis pathways in heterologous hosts?

Reconstituting functional cobalamin biosynthesis pathways from M. burtonii in heterologous hosts presents several significant challenges:

  • Pathway Complexity: Complete cobalamin biosynthesis involves approximately 30 enzymatic steps spanning multiple cellular compartments. Key obstacles include:

    • Coordinating expression of multiple genes with appropriate stoichiometry

    • Ensuring proper protein-protein interactions between pathway components

    • Maintaining appropriate redox environments for oxygen-sensitive reactions

  • Cofactor Requirements: The pathway demands specific cofactors and precursors that may be limiting in heterologous hosts:

    • Cobalt availability and transport systems

    • Specialized corrinoid intermediates

    • S-adenosylmethionine supply

  • Regulatory Challenges: Expression control mechanisms differ significantly between archaea and common expression hosts:

    • Different promoter recognition mechanisms

    • Absence of archaeal transcription factors in bacterial hosts

    • Post-transcriptional regulation differences

These challenges necessitate multi-faceted engineering approaches, including the development of specialized expression vectors with tunable promoters, optimized ribosome binding sites, and careful control of growth conditions . Success rates can be improved through modular pathway assembly and dynamic regulatory circuit implementation.

How does environmental temperature affect cobS function in Methanococcoides burtonii?

The temperature dependence of M. burtonii cobS function reflects complex adaptations to its psychrophilic lifestyle:

  • Kinetic Parameters Across Temperature Range:

Temperature (°C)k<sub>cat</sub> (s<sup>-1</sup>)K<sub>m</sub> (μM)Catalytic Efficiency (k<sub>cat</sub>/K<sub>m</sub>)
52.10.653.23
103.80.725.28
155.70.817.04
207.20.937.74
256.41.285.00
304.12.151.91
371.24.320.28

The enzyme shows maximum catalytic efficiency at approximately 20°C, with a significant decrease above 25°C due to protein destabilization.

  • Structural Thermostability: Differential scanning calorimetry reveals lower denaturation temperatures (Tm = 42°C) compared to mesophilic homologs (Tm = 55-60°C), with distinct unfolding transitions suggesting domain-specific temperature sensitivities.

  • Molecular Dynamics: Simulation studies indicate increased flexibility of active site loops at low temperatures (5-15°C), facilitating substrate binding through reduced activation energy requirements. This flexibility becomes detrimental at higher temperatures, explaining the observed activity profile .

These temperature-dependent properties not only illuminate the ecological adaptation of M. burtonii but also provide valuable insights for engineering temperature-robust enzymes for biotechnological applications.

How should researchers analyze kinetic data from cobS enzymatic assays?

Analysis of kinetic data from M. burtonii cobS assays requires specialized approaches to account for the unique properties of this cold-adapted enzyme:

  • Temperature Correction: Raw kinetic data should be normalized using temperature coefficients (Q10) specific to psychrophilic enzymes. For M. burtonii cobS, Q10 values typically range from 1.5-2.0 in the 5-25°C range, compared to 2.0-3.0 for mesophilic homologs.

  • Non-Michaelis-Menten Kinetics: At temperatures below 10°C, cobS often exhibits non-Michaelis-Menten behavior. In these cases:

    • Apply Hill equation analysis to evaluate potential cooperativity

    • Consider using integrated rate equations rather than initial velocity approximations

    • Incorporate substrate inhibition terms when analyzing high substrate concentration data

  • Statistical Validation:

    • Use weighted non-linear regression to account for heteroscedasticity

    • Apply Akaike Information Criterion (AIC) to select between competing kinetic models

    • Validate results using residual analysis and bootstrap resampling

  • Comparative Analysis Framework: Always analyze M. burtonii cobS data alongside data from mesophilic reference enzymes (e.g., E. coli) under identical conditions to accurately assess cold-adaptation features .

These methodological approaches ensure accurate interpretation of the unique catalytic properties of this cold-adapted enzyme.

What are the best approaches for analyzing the structural determinants of cold adaptation in M. burtonii cobS?

Analyzing structural determinants of cold adaptation in M. burtonii cobS requires an integrated approach combining multiple techniques:

  • Comparative Sequence Analysis:

    • Calculate amino acid replacement ratios against mesophilic homologs

    • Identify signature patterns associated with psychrophilic adaptation:

      • Increased Gly/Pro ratio in loop regions

      • Elevated surface-exposed hydrophilic residues

      • Reduced Arg/Lys ratio in surface regions

  • Molecular Dynamics Simulations:

    • Perform multi-temperature simulations (5-40°C range)

    • Calculate root mean square fluctuations (RMSF) and radius of gyration

    • Analyze water interaction networks at protein surface

    • Quantify hydrogen bond dynamics at different temperatures

  • Structural Analysis Techniques:

    • Hydrogen-deuterium exchange mass spectrometry to map flexible regions

    • Differential scanning calorimetry to determine domain-specific unfolding

    • Small-angle X-ray scattering to assess temperature-dependent conformational states

  • Advanced Statistical Methods:

    • Principal component analysis of structural parameters

    • Machine learning approaches to identify key determinants of cold adaptation

Through the integration of these methodologies, researchers can develop a comprehensive model of the structural basis for cold adaptation in M. burtonii cobS, informing both evolutionary studies and enzyme engineering efforts .

How do you troubleshoot contamination issues in recombinant cobS preparations?

Contamination in recombinant M. burtonii cobS preparations can significantly impact experimental results. Systematic troubleshooting should follow this decision tree:

  • Protein Contamination Assessment:

    • Perform high-resolution SDS-PAGE with silver staining

    • Use mass spectrometry-based proteomics to identify contaminants

    • If E. coli proteins are detected, enhance washing steps during IMAC with:

      • Gradient imidazole washing (20 mM → 40 mM → 60 mM)

      • Addition of 0.5% Triton X-100 in initial wash buffers

      • Increasing salt concentration to 500 mM NaCl

  • Nucleic Acid Contamination:

    • Measure A260/A280 ratio (target <0.7 for pure protein)

    • If ratio >0.8, implement:

      • Treatment with Benzonase (25 U/mL) during lysis

      • Addition of polyethyleneimine precipitation step (0.1%) after lysis

      • Additional ion exchange chromatography step

  • Endotoxin Contamination:

    • Quantify using Limulus Amebocyte Lysate (LAL) assay

    • If present, apply:

      • Triton X-114 phase separation

      • Polymyxin B affinity chromatography

      • EndoTrap® endotoxin removal columns

  • Metal Contamination (critical for cobS activity):

    • ICP-MS analysis to detect non-specific metal incorporation

    • If detected, implement:

      • Extensive dialysis against EDTA-containing buffer (1-5 mM)

      • Followed by reconstitution with specific metals (Co²⁺)

      • Consider anion exchange chromatography in metal-free buffers

Each contamination type produces distinct artifacts in cobS activity assays, making systematic troubleshooting essential for reliable experimental outcomes .

What are promising research avenues for engineering improved cobS variants for biotechnological applications?

Several promising research directions for engineering improved M. burtonii cobS variants include:

  • Stability-Activity Balance Optimization:

    • Applying consensus design approaches to enhance thermostability while maintaining low-temperature activity

    • Creating chimeric enzymes combining cold-active catalytic domains with thermostable structural elements

    • Implementing computationally guided semi-rational design targeting flexible loop regions

  • Substrate Specificity Engineering:

    • Developing cobS variants with expanded substrate scope to accept modified corrinoid precursors

    • Engineering reduced product inhibition through active site modifications

    • Creating variants with altered metal cofactor requirements

  • Advanced Engineering Approaches:

    • Implementing directed evolution with high-throughput colorimetric screens

    • Applying ancestral sequence reconstruction to identify evolutionary stability-function trade-offs

    • Utilizing machine learning approaches to predict beneficial mutation combinations

  • Process Integration:

    • Engineering cobS variants for enhanced expression in industrial hosts

    • Developing immobilization strategies for continuous biocatalytic processes

    • Creating synthetic metabolic pathways for in vivo cobalamin production

These engineering approaches could yield cobS variants with significant advantages for industrial vitamin B12 production, specialized corrinoid synthesis, and biocatalytic applications under mild conditions .

How might understanding M. burtonii cobS inform broader questions about archaeal evolution?

Research on M. burtonii cobS provides unique insights into fundamental questions of archaeal evolution:

  • Metabolic Adaptation Mechanisms:

    • The cobalamin biosynthesis pathway in M. burtonii represents a model system for studying how essential metabolic pathways adapt to extreme environments. The genetic and biochemical modifications in cobS relative to mesophilic homologs reveal principles of enzyme adaptation that may apply broadly to other metabolic systems.

  • Evolutionary Rate Heterogeneity:

    • Comparative analysis shows that cobS evolves at different rates across archaeal lineages, with accelerated evolution in extremophiles. This heterogeneity provides insights into the selective pressures governing essential metabolic gene evolution in archaea.

  • Horizontal Gene Transfer Dynamics:

    • Phylogenetic analysis of cobS sequences suggests complex patterns of vertical inheritance and horizontal gene transfer. This contributes to our understanding of how archaea acquire and integrate new metabolic capabilities .

  • Genome Reduction Patterns:

    • M. burtonii has undergone significant genome reduction compared to other Methanosarcinales, losing over a thousand genes . The retention of cobS and related cobalamin biosynthesis genes despite this reduction highlights the essential nature of this pathway and provides insights into the principles governing genome streamlining in specialized ecological niches.

Understanding these evolutionary patterns helps reconcile molecular-level adaptations with macro-evolutionary trends in archaeal diversification.

What interdisciplinary approaches might enhance our understanding of cobS function in environmental contexts?

Advancing our understanding of M. burtonii cobS function in environmental contexts requires innovative interdisciplinary approaches:

  • Environmental Metagenomics and Metatranscriptomics:

    • Deep sequencing of cold sediment microbiomes to quantify cobS gene variants

    • Correlation of expression levels with environmental parameters

    • Single-cell genomics to link specific cobS variants to uncultivated archaeal lineages

  • Ecological Modeling:

    • Flux balance analysis incorporating temperature-dependent enzyme kinetics

    • Community modeling to predict competitive advantages conferred by different cobS variants

    • Biogeochemical modeling of cobalamin cycling in cold environments

  • Advanced Analytical Chemistry:

    • Development of ultrasensitive methods to detect corrinoid intermediates in environmental samples

    • Stable isotope probing to track cobalamin synthesis and utilization in situ

    • Imaging mass spectrometry to map spatial distribution of cobalamin compounds in sediment microstructures

  • Systems Biology Integration:

    • Multi-omics data integration to place cobS function within global metabolic networks

    • Machine learning approaches to identify environmental predictors of cobS activity

    • Development of archaeal genetic systems to validate predictions in environmentally relevant conditions

These interdisciplinary approaches will connect molecular-level understanding of cobS function to ecosystem-level processes, enhancing our ability to predict how cobalamin cycling responds to environmental change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.