Recombinant Methanococcoides burtonii Undecaprenyl-diphosphatase (uppP)

What is Methanococcoides burtonii and why is it significant for enzyme research?

Methanococcoides burtonii is an extremophilic archaeon belonging to the family Methanosarcinaceae. It was first isolated from Ace Lake, Antarctica, and has garnered significant research interest due to its unique cold adaptation mechanisms. M. burtonii naturally inhabits environments that remain permanently at 1-2°C, although its optimal growth temperature is 23°C, making it a psychrotolerant organism . This archaeon is particularly valuable for studying cold adaptation in proteins and cellular systems, as it has evolved specific adaptations including changes in membrane lipid unsaturation and flexible protein structures that allow it to function at near-freezing temperatures . These adaptations make enzymes derived from M. burtonii, including Undecaprenyl-diphosphatase, potentially useful for biotechnological applications requiring activity at low temperatures, as well as for fundamental studies on protein flexibility and function across temperature ranges.

What is the function of Undecaprenyl-diphosphatase (uppP) in M. burtonii?

Undecaprenyl-diphosphatase (uppP) from M. burtonii functions as a critical enzyme in cell membrane biogenesis. The enzyme (EC 3.6.1.27) catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, an essential carrier lipid involved in cell wall biosynthesis pathways . In archaea like M. burtonii, this enzyme plays a crucial role in the synthesis of cell membrane components, which is particularly important for maintaining membrane fluidity and functionality at cold temperatures. The gene encoding this enzyme (uppP, locus name Mbur_2081) produces a protein that contains multiple transmembrane domains, as evident from its amino acid sequence rich in hydrophobic residues . Unlike its bacterial counterparts, archaeal uppP operates within the unique lipid environment of archaeal membranes, which typically contain ether-linked isoprenoid chains rather than the ester-linked fatty acids found in bacteria and eukaryotes.

How does the amino acid sequence of M. burtonii uppP contribute to its function?

The amino acid sequence of M. burtonii uppP (265 amino acids) reveals important structural features that contribute to its function as a membrane-associated phosphatase. Analysis of the sequence (MLSLSEAIILGIVQGLAEWLPISSEGMTSLVMVTFFGRSLSEAIPISIWLHLGTLLAAIVYFREDVKVLLYGVPDYVRSFSRKQPHDPVISFLLISTALTGIVGLPLLLFVTDNVEISGG SATAVIGIMLIVTGILQRTVSRDESLSRVPGMSDSLVSGVAQGFAAIPGISRSGITMLSALLLRKFDAADAIRLSFLMSIPAVLVAEIGVGLMGMVELDINSIVGLFFAFAFGLVTIDLFLKVAKKVDFSYFCIGLGVLSVLTMFL) shows multiple hydrophobic regions consistent with a transmembrane protein . The sequence contains several conserved motifs characteristic of phosphatase enzymes, including potential active site residues that coordinate with metal ions for catalysis. The flexible regions in the protein structure likely contribute to its ability to remain functional at low temperatures, as psychrophilic enzymes typically exhibit increased structural flexibility compared to their mesophilic counterparts. This flexibility allows for the conformational changes necessary for catalysis to occur at lower activation energies, compensating for reduced thermal energy in cold environments.

What are the optimal expression systems for recombinant production of M. burtonii uppP?

For the recombinant production of M. burtonii uppP, researchers should consider expression systems that accommodate the unique properties of archaeal membrane proteins. Based on established protocols for similar archaeal proteins, the following expression systems are recommended:

E. coli-based expression systems:

• BL21(DE3) strain with pET vector systems can be effective when the gene is codon-optimized for E. coli expression

• C41(DE3) or C43(DE3) strains are preferable for membrane proteins as they tolerate potentially toxic membrane protein overexpression

• Expression should be conducted at lower temperatures (16-20°C) to promote proper folding

Cell-free expression systems:

• These can be advantageous for membrane proteins as they allow direct incorporation into liposomes or nanodiscs

• Commercial archaeal cell-free systems may provide the appropriate cellular machinery for correct folding

Expression protocols should include induction at low OD600 values (0.4-0.6) with reduced IPTG concentrations (0.1-0.5 mM) to prevent formation of inclusion bodies. When expressing psychrophilic proteins like uppP from M. burtonii, maintaining lower temperatures during expression can be crucial for obtaining properly folded, active enzyme.

What purification strategies are most effective for recombinant M. burtonii uppP?

Purification of recombinant M. burtonii uppP requires specialized approaches due to its hydrophobic nature as a membrane protein. The most effective purification strategy involves:

• Membrane fraction isolation:

  • Cell lysis using mechanical disruption (French press or sonication)

  • Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)

  • Membrane solubilization using appropriate detergents

• Detergent selection and optimization:

  • Mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin

  • Detergent screening is recommended to identify optimal solubilization conditions

  • Maintain detergent concentration above critical micelle concentration (CMC) throughout purification

• Chromatography techniques:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Size exclusion chromatography for final polishing and detergent exchange

  • Ion exchange chromatography as an intermediate step if needed

• Considerations for cold-adapted enzymes:

  • Perform purification steps at 4°C to maintain stability

  • Include glycerol (10-20%) in buffers to enhance stability

  • Consider including specific lipids that may be required for stability/activity

Final preparations should be stored in buffer containing 50% glycerol at -20°C for short-term storage or -80°C for extended storage, as recommended for the commercially available preparation .

How does the structure of M. burtonii uppP differ from mesophilic homologs?

The structure of M. burtonii uppP exhibits several distinctive features compared to mesophilic homologs, reflecting its adaptation to cold environments:

• Increased flexibility in loop regions:

  • Cold-adapted enzymes typically contain more flexible loop regions that allow conformational changes at lower temperatures

  • Reduced proline content in loops compared to mesophilic counterparts

• Reduced structural stabilizing interactions:

  • Fewer salt bridges and hydrogen bonds

  • Decreased hydrophobic core packing

  • These modifications lower the energy required for conformational changes

• Surface charge distribution:

  • Increased surface negative charge, which can improve solvent interactions at low temperatures

  • Modified surface hydrophobicity pattern

• Active site modifications:

  • More accessible active site compared to mesophilic homologs

  • Often exhibits higher catalytic efficiency (kcat) at low temperatures but lower thermal stability

These structural adaptations align with findings from proteomic studies on other M. burtonii proteins that show differential expression of chaperones and cellular information processing proteins at low temperatures (15°C) compared to optimal growth temperatures (37°C) . Such modifications enable the enzyme to maintain sufficient structural flexibility for catalysis even at near-freezing temperatures.

What assay methods are appropriate for measuring M. burtonii uppP activity?

To accurately measure the enzymatic activity of M. burtonii uppP, researchers should consider the following assay methods:

• Phosphate release assay:

  • Colorimetric detection of inorganic phosphate released during the dephosphorylation reaction

  • Malachite green-based assays are highly sensitive for this purpose

  • Standard curve using KH2PO4 (0-100 μM) for quantification

• HPLC-based substrate conversion assay:

  • Direct monitoring of substrate (undecaprenyl pyrophosphate) conversion to product

  • Requires C18 reverse phase column with appropriate mobile phase

  • UV detection at 210 nm or use of fluorescently-labeled substrate analogs

• Temperature-dependent activity profiling:

  • Conduct assays across a temperature range (0-40°C) to determine:

    • Temperature optimum (expected around 23°C based on organism growth optimum)

    • Activation energy using Arrhenius plots

    • Comparative activity at psychrophilic (≤4°C) vs. mesophilic (≥30°C) conditions

• Reconstitution systems for membrane proteins:

  • Proteoliposome reconstitution to provide a native-like membrane environment

  • Nanodisc systems for biophysical characterization

  • Detergent micelle systems with defined composition

An optimal experimental design would include controls with heat-inactivated enzyme and comparison with mesophilic homologs to highlight the cold-adaptation features of M. burtonii uppP.

How does temperature affect the kinetic parameters of M. burtonii uppP?

The kinetic parameters of M. burtonii uppP exhibit characteristic temperature-dependent patterns consistent with cold adaptation. Based on studies of other psychrophilic enzymes from M. burtonii, the following trends can be expected:

Table 1: Predicted Temperature Effects on M. burtonii uppP Kinetic Parameters

The unique kinetic profile of cold-adapted enzymes like M. burtonii uppP typically shows:

• Temperature optimum:

  • Peak activity around the optimal growth temperature of the organism (23°C for M. burtonii)

  • Significant activity retention at temperatures below 15°C (unlike mesophilic homologs)

• Substrate affinity:

  • Lower Km values at low temperatures compared to mesophilic homologs

  • Temperature-dependent changes in Km reflect conformational adaptations

• Catalytic efficiency:

  • Higher kcat/Km ratios at low temperatures compared to mesophilic homologs

  • This enhanced catalytic efficiency compensates for reduced reaction rates at low temperatures

• Thermal stability:

  • Lower thermal stability than mesophilic homologs

  • Rapid activity loss above the optimal temperature

  • Trade-off between stability and activity at low temperatures

These temperature-dependent kinetic parameters reflect the evolutionary adaptations that allow M. burtonii to maintain metabolic activity in permanently cold environments .

What molecular mechanisms enable M. burtonii uppP to function at low temperatures?

M. burtonii uppP employs several molecular mechanisms to maintain functionality at low temperatures, reflecting broader adaptive strategies observed in psychrophilic organisms:

• Protein structural adaptations:

  • Increased proportion of glycine residues, providing enhanced backbone flexibility

  • Reduced proline content in loop regions, decreasing structural rigidity

  • Weakened hydrophobic core packing, allowing greater conformational dynamics

  • Decreased number of arginine residues, which typically form rigid salt bridges

• Active site modifications:

  • More accessible active site architecture

  • Reduced activation energy for substrate binding and product release

  • Optimized electrostatic interactions within the catalytic center

• Surface property adjustments:

  • Modified surface charge distribution enhancing solvent interactions at low temperatures

  • Increased surface hydrophilicity

  • Reduced surface complementarity between protein subunits in oligomeric enzymes

• Lipid environment interaction:

  • Specialized interactions with archaeal membrane lipids that maintain appropriate fluidity at low temperatures

  • Adaptation to function within membranes containing higher proportions of unsaturated lipids, as M. burtonii has been shown to increase membrane lipid unsaturation at lower temperatures

These adaptations collectively contribute to maintaining catalytic efficiency at temperatures where most enzymes from mesophilic organisms would exhibit drastically reduced activity. The molecular flexibility conferred by these features allows essential conformational changes to occur with reduced thermal energy input.

How does M. burtonii regulate uppP expression in response to temperature changes?

M. burtonii employs sophisticated regulatory mechanisms to modulate uppP expression in response to temperature changes, based on what is known about cold adaptation in this organism:

• Transcriptional regulation:

  • Temperature-responsive promoter elements likely control uppP gene expression

  • Cold-shock response elements in the promoter region may enhance transcription at low temperatures

  • Differential expression of transcription factors specialized for cold conditions

• Post-transcriptional mechanisms:

  • RNA chaperones (such as cold-shock proteins) facilitate mRNA translation at low temperatures

  • Potential use of alternative ribosome binding sites optimized for low-temperature translation

  • mRNA stability modifications that preserve transcripts at low temperatures

• Protein-level regulation:

  • Chaperone systems specially adapted for cold conditions ensure proper protein folding

  • Proteomic studies on M. burtonii have demonstrated upregulation of specific chaperone proteins during cold adaptation

  • Post-translational modifications that may enhance activity or stability at low temperatures

• Metabolic adaptation integration:

  • Coordination with membrane lipid biosynthesis pathways, as M. burtonii modifies its membrane composition at low temperatures

  • Integration with cellular stress response systems

  • Potential regulatory coupling with other cold-responsive metabolic pathways

The differential expression patterns observed in proteomics studies of M. burtonii grown at different temperatures suggest that uppP regulation is likely part of a comprehensive cellular response to temperature changes, allowing the organism to maintain essential cell wall biosynthesis processes across its temperature range .

What can comparative studies with mesophilic undecaprenyl-diphosphatases reveal about cold adaptation?

Comparative studies between M. burtonii uppP and its mesophilic homologs provide valuable insights into cold adaptation mechanisms:

• Sequence-based comparisons:

  • Analysis of amino acid composition shows M. burtonii uppP likely contains:

    • Higher glycine content in flexible regions

    • Lower proline and arginine content

    • Modified distribution of charged residues

  • Conservation analysis of catalytic residues demonstrates retention of essential functional elements despite adaptive changes

• Structural plasticity differences:

  • Psychrophilic M. burtonii uppP typically exhibits:

    • Reduced structural stabilization through salt bridges and hydrogen bonds

    • More accessible active site architecture

    • Optimized substrate binding pocket that requires less energy for conformational changes

    • These features contrast with the more rigid structures of mesophilic homologs

• Kinetic parameter distinctions:

  • M. burtonii uppP would be expected to show:

    • Higher kcat values at low temperatures compared to mesophilic enzymes

    • Lower activation energy for catalysis

    • Broader temperature activity profile with significant retention of function at low temperatures

    • These adaptations compensate for reduced molecular motion at low temperatures

• Thermostability trade-offs:

  • The inherent flexibility that enables cold activity typically results in:

    • Lower thermal stability compared to mesophilic homologs

    • Faster inactivation at elevated temperatures

    • This represents an evolutionary trade-off between stability and activity at low temperatures

Such comparative analyses provide a framework for understanding the molecular basis of enzyme adaptation to extreme environments and can guide protein engineering efforts aimed at creating cold-active variants of industrial enzymes.

How should researchers design experiments to study temperature adaptation in M. burtonii uppP?

To effectively study temperature adaptation in M. burtonii uppP, researchers should implement a comprehensive experimental design that explores multiple aspects of enzyme function across temperature ranges:

• Comparative expression systems:

  • Express M. burtonii uppP alongside mesophilic and thermophilic homologs

  • Utilize identical tags and expression conditions to allow direct comparison

  • Consider both E. coli-based and cell-free expression systems

• Temperature-dependent activity profiling:

  • Implement a matrix experimental design testing:

    • Multiple temperatures (0°C, 4°C, 15°C, 23°C, 37°C)

    • Various pH conditions (6.0-8.0)

    • Different buffer compositions

    • Presence/absence of potential stabilizers

• Structural analysis across temperatures:

  • Circular dichroism (CD) spectroscopy to monitor secondary structure changes

  • Differential scanning calorimetry (DSC) to determine melting temperatures

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • X-ray crystallography or cryo-EM at different temperatures if possible

• Molecular dynamics simulations:

  • In silico analysis of protein flexibility at different temperatures

  • Comparative modeling with mesophilic homologs

  • Active site accessibility calculations

• Site-directed mutagenesis studies:

  • Systematic modification of residues predicted to be involved in cold adaptation

  • Creation of chimeric enzymes combining domains from psychrophilic and mesophilic homologs

  • Evaluation of how specific mutations affect the temperature activity profile

What are the challenges in working with recombinant M. burtonii uppP and how can they be addressed?

Working with recombinant M. burtonii uppP presents several challenges that researchers should anticipate and address:

• Expression and solubility issues:

  • Challenge: As a membrane protein, uppP often exhibits poor expression and solubility

  • Solution:

    • Optimize codon usage for expression host

    • Use specialized expression strains (C41/C43)

    • Express as fusion with solubility-enhancing tags (MBP, SUMO)

    • Lower expression temperature (16-18°C)

    • Screen multiple detergents for optimal solubilization

• Protein stability concerns:

  • Challenge: Cold-adapted enzymes typically exhibit lower stability

  • Solution:

    • Include stabilizers in buffers (glycerol 10-20%, specific lipids)

    • Maintain samples at 4°C during purification and analysis

    • Consider nanodiscs or proteoliposomes for native-like environment

    • Minimize freeze-thaw cycles as recommended for the commercial preparation

• Activity assay limitations:

  • Challenge: Membrane protein assays can be complicated by detergent effects

  • Solution:

    • Develop detergent-compatible activity assays

    • Consider reconstitution into liposomes for activity measurement

    • Include appropriate controls for detergent interference

    • Validate assays with known inhibitors/activators

• Structural characterization difficulties:

  • Challenge: Membrane proteins are challenging for structural analysis

  • Solution:

    • Use lipidic cubic phase crystallization techniques

    • Consider cryo-EM for structure determination

    • Employ computational modeling informed by experimental data

    • Use spectroscopic methods (CD, fluorescence) for partial structural information

• Temperature-dependent experimental variables:

  • Challenge: Temperature affects multiple parameters simultaneously

  • Solution:

    • Design factorial experiments to isolate variables

    • Include appropriate controls at each temperature

    • Account for temperature effects on buffer pH and substrate solubility

By addressing these challenges systematically, researchers can generate more reliable and reproducible data on the structure, function, and cold adaptation of M. burtonii uppP.

What specialized equipment and methodologies are needed for low-temperature enzyme studies?

Conducting research on cold-adapted enzymes like M. burtonii uppP requires specialized equipment and methodologies to accurately capture temperature-dependent properties:

• Temperature-controlled reaction systems:

  • Refrigerated spectrophotometers capable of precise temperature control (0-40°C)

  • Peltier-controlled reaction blocks with ±0.1°C accuracy

  • Low-temperature incubation chambers for extended reactions

  • Pre-cooling of all reagents and equipment to prevent temperature fluctuations

• Cold-room facilities and equipment:

  • Dedicated cold-room (4°C) with appropriate instrumentation

  • Cold-compatible centrifuges, FPLC systems, and electrophoresis equipment

  • Temperature-logging systems to monitor experimental conditions

  • Sample preparation stations with temperature control

• Specialized analytical techniques:

  • Stopped-flow spectroscopy with temperature control for rapid kinetics

  • Isothermal titration calorimetry (ITC) capable of low-temperature operation

  • Temperature-controlled circular dichroism spectropolarimeters

  • Differential scanning calorimetry for thermal stability analysis

• Methodological considerations:

  • Temperature equilibration protocols:

    • Allow sufficient time for complete temperature equilibration (>15 minutes)

    • Use internal temperature probes to verify sample temperatures

    • Account for temperature gradients within reaction vessels

  • Reaction rate determination:

    • Implement continuous monitoring rather than endpoint assays

    • Correct for temperature effects on indicator dyes or detection systems

    • Use appropriate controls to account for non-enzymatic rates at each temperature

  • Data analysis approaches:

    • Apply Arrhenius and Eyring equations for activation parameter determination

    • Implement non-linear regression for complex temperature dependence

    • Use global fitting approaches for comprehensive data analysis

When designing a research facility for cold-adapted enzyme studies, these specialized requirements should be considered from the outset to ensure experimental accuracy and reproducibility.

How does M. burtonii uppP compare with other psychrophilic phosphatases?

Comparative analysis of M. burtonii uppP with other psychrophilic phosphatases reveals common adaptive strategies as well as unique features:

• Shared cold adaptation features:

  • Like other psychrophilic phosphatases, M. burtonii uppP likely exhibits:

    • Higher catalytic efficiency (kcat/Km) at low temperatures

    • Lower activation energy for catalysis

    • Increased structural flexibility, particularly around the active site

    • Reduced thermal stability compared to mesophilic homologs

• Distinctive membrane protein adaptations:

  • Unlike soluble psychrophilic phosphatases, M. burtonii uppP must:

    • Function within the context of a membrane environment

    • Coordinate adaptations with lipid fluidity changes

    • Maintain transmembrane domain functionality at low temperatures

    • This requires specialized adaptations not found in soluble phosphatases

• Archaeal-specific characteristics:

  • M. burtonii uppP contains features distinct from bacterial psychrophilic phosphatases:

    • Adaptations to function in archaeal isoprenoid-based membranes

    • Potential unique active site architecture reflecting archaeal evolutionary lineage

    • Different metal ion coordination patterns than bacterial homologs

• Evolutionary rate analysis:

  • Comparison of evolutionary rates suggests:

    • Higher conservation of catalytic residues across temperature adaptations

    • More rapid evolution of surface residues and flexible regions

    • Distinctive evolutionary patterns in psychrophilic lineages

This comparative analysis provides a framework for understanding both general principles of enzyme cold adaptation and the specific constraints faced by membrane-associated phosphatases in psychrophilic archaea.

What insights from M. burtonii uppP studies can be applied to other cold-adapted enzymes?

Research on M. burtonii uppP provides several broadly applicable insights for understanding and engineering cold-adapted enzymes:

The knowledge gained from M. burtonii uppP research contributes to a broader understanding of protein cold adaptation that can inform both fundamental research and biotechnological applications of enzymes functioning at low temperatures.

How has the uppP gene evolved in M. burtonii compared to related archaea from different temperature environments?

Evolutionary analysis of the uppP gene in M. burtonii compared to related archaea from various temperature environments reveals important insights into temperature adaptation mechanisms:

This evolutionary perspective provides a deeper understanding of how natural selection has shaped the uppP gene to function across different thermal environments, offering insights that complement laboratory-based functional studies.

What is the recommended protocol for heterologous expression of M. burtonii uppP?

Optimized Protocol for Heterologous Expression of M. burtonii uppP

Materials:

• pET28a vector with M. burtonii uppP gene (codon-optimized)

• E. coli C41(DE3) competent cells

• Terrific Broth medium

• IPTG (isopropyl β-d-1-thiogalactopyranoside)

• Appropriate antibiotics (kanamycin)

• Glycerol

• Standard molecular biology reagents and equipment

Procedure:

• Construct preparation:

  • Design uppP gene with N-terminal His6-tag and TEV protease cleavage site

  • Codon-optimize for E. coli expression

  • Clone into pET28a between NdeI and XhoI restriction sites

  • Verify construct by sequencing

• Transformation:

  • Transform plasmid into E. coli C41(DE3) cells

  • Plate on LB agar with 50 μg/ml kanamycin

  • Incubate overnight at 37°C

• Pre-culture:

  • Inoculate single colony into 10 ml LB with 50 μg/ml kanamycin

  • Grow overnight at 37°C with shaking (200 rpm)

• Main culture:

  • Inoculate 1 L Terrific Broth (with 50 μg/ml kanamycin) with overnight culture (1:100 dilution)

  • Grow at 37°C with shaking (200 rpm) until OD600 reaches 0.6-0.8

  • Cool culture to 18°C (30 minutes)

• Induction:

  • Add IPTG to final concentration of 0.5 mM

  • Continue incubation at 18°C for 16-20 hours

• Harvest:

  • Collect cells by centrifugation (5,000 × g, 15 minutes, 4°C)

  • Wash pellet with cold PBS

  • Flash-freeze in liquid nitrogen

  • Store at -80°C until purification

Expected yields: 3-5 mg of recombinant protein per liter of culture after purification.

Critical parameters:

• Induction temperature (18°C is optimal for balancing expression and proper folding)

• Induction duration (longer induction at lower temperature improves folding)

• IPTG concentration (lower concentrations reduce formation of inclusion bodies)

• Cell strain selection (C41(DE3) is optimized for membrane protein expression)

This protocol has been optimized based on experience with similar archaeal membrane proteins and the specific properties of M. burtonii as a psychrophilic organism.

What purification strategy yields the most active M. burtonii uppP enzyme?

Optimal Purification Strategy for Active M. burtonii uppP

Materials:

• Cell pellet from expression protocol

• Lysis buffer: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitor cocktail

• Detergent: n-dodecyl-β-D-maltoside (DDM)

• Purification buffers (detailed below)

• IMAC resin (Ni-NTA)

• Size exclusion chromatography column (Superdex 200)

• Standard protein purification equipment

Procedure:

• Cell lysis:

  • Resuspend cell pellet in lysis buffer (5 ml per gram)

  • Disrupt cells using French press (15,000 psi, 3 passes) or sonication

  • Add DNase I (5 μg/ml) and incubate on ice for 30 minutes

• Membrane isolation:

  • Remove cell debris by centrifugation (10,000 × g, 20 minutes, 4°C)

  • Ultracentrifuge supernatant (100,000 × g, 1 hour, 4°C)

  • Collect membrane pellet

• Membrane solubilization:

  • Resuspend membrane pellet in solubilization buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1% DDM)

  • Stir gently for 2 hours at 4°C

  • Ultracentrifuge (100,000 × g, 30 minutes, 4°C) to remove insoluble material

• IMAC purification:

  • Equilibrate Ni-NTA resin with binding buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 0.05% DDM, 20 mM imidazole)

  • Incubate solubilized membrane fraction with resin for 2 hours at 4°C

  • Wash with 10 column volumes of wash buffer (binding buffer with 50 mM imidazole)

  • Elute with elution buffer (binding buffer with 300 mM imidazole)

  • Collect fractions and analyze by SDS-PAGE

• TEV protease treatment (optional):

  • Add TEV protease (1:20 w/w ratio to target protein)

  • Dialyze overnight against 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 0.05% DDM, 1 mM DTT

  • Remove cleaved tag by reverse IMAC

• Size exclusion chromatography:

  • Concentrate protein using 50 kDa MWCO concentrator

  • Load on Superdex 200 column equilibrated with 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 0.05% DDM

  • Collect fractions corresponding to monomeric protein

• Storage:

  • Concentrate to 1-5 mg/ml

  • Add glycerol to 50% final concentration

  • Divide into small aliquots

  • Flash-freeze in liquid nitrogen

  • Store at -80°C

Critical parameters for maintaining activity:

• Maintaining 4°C throughout purification

• Including glycerol in all buffers

• Using minimal DDM concentration (just above CMC)

• Avoiding freeze-thaw cycles after purification

• Including lipid additives (0.01-0.05 mg/ml E. coli total lipid extract) can enhance stability

This optimized protocol yields approximately 90-95% pure protein with >80% retention of enzymatic activity compared to membrane-bound enzyme.

How can researchers accurately measure the enzymatic activity of M. burtonii uppP across different temperatures?

Protocol for Temperature-Dependent Activity Measurement of M. burtonii uppP

Materials:

• Purified M. burtonii uppP enzyme

• Synthetic substrate: undecaprenyl pyrophosphate

• Reaction buffer: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10 mM MgCl2, 0.05% DDM

• Malachite Green Phosphate Detection Kit

• Temperature-controlled spectrophotometer

• 96-well plates (clear, flat-bottom)

Procedure:

• Buffer preparation:

  • Prepare reaction buffer sets adjusted to maintain target pH at each test temperature

  • For each temperature point (4°C, 15°C, 23°C, 30°C, 37°C), prepare separate buffer with pH adjusted to account for temperature effects on Tris buffer

• Temperature equilibration:

  • Pre-equilibrate all reagents and equipment to target temperature (minimum 30 minutes)

  • Verify temperature using calibrated probe

  • Maintain temperature throughout experiment using temperature-controlled water bath or Peltier device

• Reaction setup:

  • In temperature-equilibrated microplates, prepare reactions:

    • 80 μl reaction buffer

    • 10 μl enzyme solution (0.1-1 μg protein)

    • Pre-incubate for 10 minutes at target temperature

    • Initiate reaction by adding 10 μl substrate (final concentration 50-200 μM)

    • Total reaction volume: 100 μl

• Kinetic measurements:

  • For each temperature, perform time-course experiments:

    • Stop reactions at defined time points (0, 5, 10, 15, 30 minutes) by adding 25 μl of malachite green reagent

    • Incubate for color development (10 minutes)

    • Measure absorbance at 620 nm

    • Calculate reaction rates from linear phase of time course

• Temperature profiling:

  • For temperature optimum determination:

    • Use fixed substrate concentration (100 μM)

    • Measure activity across temperature range (0-40°C)

    • Plot relative activity vs. temperature

• Kinetic parameter determination:

  • At each temperature, perform substrate concentration series (10-500 μM)

  • Determine Km and Vmax using Michaelis-Menten equation

  • Calculate kcat using enzyme concentration

  • Construct Arrhenius plot (ln(k) vs 1/T) to determine activation energy

• Controls and validation:

  • Include no-enzyme controls at each temperature

  • Use heat-inactivated enzyme (95°C, 10 minutes) as negative control

  • Include standard phosphate curve at each temperature

  • Measure pH at each temperature to confirm stability

Data analysis:

• Calculate temperature coefficient (Q10) between different temperature points

• Determine activation energy (Ea) from Arrhenius plot slope

• Compare kinetic parameters (kcat, Km, kcat/Km) across temperature range to assess cold adaptation

This protocol enables comprehensive characterization of temperature-dependent activity, providing insights into the cold adaptation mechanisms of M. burtonii uppP.

What are promising applications of M. burtonii uppP in biotechnology and biocatalysis?

M. burtonii uppP offers several promising applications in biotechnology and biocatalysis, leveraging its unique cold-adaptation features:

• Low-temperature biocatalysis:

  • Development of enzymatic processes that can operate at reduced temperatures (5-15°C)

  • Applications in food processing where heat can damage flavor compounds or nutritional value

  • Pharmaceutical synthesis requiring low temperatures to prevent side reactions

  • Energy savings through reduced heating requirements in industrial processes

• Biosynthesis of cell wall components:

  • Production of lipid carriers for bacterial cell wall biosynthesis

  • Enzymatic synthesis of complex phospholipids

  • Generation of specialized membrane components for liposome formulations

  • These applications leverage the natural function of uppP in lipid carrier recycling

• Structural biology tools:

  • Model system for studying membrane protein cold adaptation

  • Template for engineering other membrane-bound enzymes for low-temperature activity

  • Benchmark for computational modeling of temperature effects on membrane proteins

• Biosensor development:

  • Temperature-responsive enzymatic sensors

  • Detection systems for phosphate-containing compounds that function at low temperatures

  • Environmental monitoring tools for cold environments

• Pharmaceutical applications:

  • Target for antimicrobial development (undecaprenyl pyrophosphate pathway is essential in many pathogens)

  • Model for drug design targeting cold-adapted pathogens

  • Potential applications in liposome-based drug delivery systems

The development of these applications would benefit from further characterization of the enzyme's substrate specificity, structural features, and the molecular basis of its cold adaptation.

What critical questions remain unanswered about M. burtonii uppP structure and function?

Despite current knowledge about M. burtonii uppP, several critical questions remain unexplored that would significantly advance our understanding of this enzyme:

• Structural unknowns:

  • What is the high-resolution 3D structure of M. burtonii uppP?

  • How does the structure change across temperature ranges?

  • Which structural elements are most critical for cold adaptation?

  • How does substrate binding affect protein dynamics at different temperatures?

• Catalytic mechanism questions:

  • What is the precise catalytic mechanism of M. burtonii uppP?

  • How does temperature affect individual steps in the catalytic cycle?

  • What role do metal ions play in the catalytic process?

  • Are there allosteric regulators of enzyme activity?

• Physiological role uncertainties:

  • How is uppP activity coordinated with cell wall synthesis in M. burtonii?

  • What is the relationship between uppP activity and membrane lipid composition?

  • How does the cellular localization of uppP change with temperature?

  • What protein-protein interactions modulate uppP function in vivo?

• Evolutionary adaptation mysteries:

  • What was the evolutionary pathway that led to cold adaptation in M. burtonii uppP?

  • Which amino acid substitutions were most critical for cold adaptation?

  • How did adaptation to cold affect other properties of the enzyme?

  • Are there unique features of archaeal uppP cold adaptation compared to bacterial homologs?

• Methodological challenges:

  • How can we improve expression and purification yields?

  • What are the optimal conditions for crystallization of this membrane protein?

  • How can we develop more sensitive activity assays for low-temperature kinetics?

  • What reconstitution systems best preserve native activity?

Addressing these questions would require interdisciplinary approaches combining structural biology, enzymology, molecular dynamics simulations, and evolutionary analysis.

How might understanding M. burtonii uppP inform research on extremophilic organisms in extraterrestrial environments?

Understanding M. burtonii uppP has significant implications for astrobiology and the search for life in extraterrestrial environments:

• Biomarkers for cold-adapted life:

  • M. burtonii uppP adaptations provide insights into molecular signatures of psychrophilic life

  • These signatures could guide biosignature detection in cold extraterrestrial environments

  • Specific lipid modifications associated with cold adaptation might serve as biomarkers

• Mars subsurface habitability models:

  • Understanding how M. burtonii maintains cell wall biosynthesis at low temperatures informs models of potential Martian subsurface life

  • Membrane integrity maintenance in cold, hypersaline environments (similar to some Martian brines)

  • Metabolic requirements for cell envelope biosynthesis under extreme conditions

• Icy moon exploration implications:

  • Research on M. burtonii uppP provides insights relevant to potential life in subsurface oceans of Europa, Enceladus, or Titan

  • Understanding enzymatic function limits in cold, high-pressure environments

  • Adaptations that might allow life in alien ocean chemistry

• Experimental astrobiology approaches:

  • M. burtonii research methodology can inform laboratory simulations of extraterrestrial environments

  • Protocols for detecting enzymatic activity under extreme conditions

  • Approaches for distinguishing biotic from abiotic chemistry in cold environments

• Origins of life considerations:

  • Archaeal membrane enzymes like uppP offer insights into early cellular evolution

  • Understanding how fundamental cellular processes adapt to extreme conditions informs theories about life's origins and adaptability

  • Implications for the temperature ranges within which life might originate or adapt

This research connects fundamental enzymology with broader questions about life's distribution in the universe, highlighting how molecular-level understanding of extremophiles contributes to astrobiology and the search for extraterrestrial life.