Recombinant Methanococcus aeolicus Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Function

CobD is a key enzyme in the anaerobic cobalamin biosynthesis pathway, facilitating the conversion of cobyrinic acid to cobyric acid by catalyzing amide bond formation on carboxylate groups . In Methanococcus aeolicus, a mesophilic methanogenic archaeon isolated from marine sediments , CobD operates within a 25-step enzymatic cascade to produce adenosylcobalamin (active vitamin B<sub>12</sub>) . Unlike aerobic organisms that utilize CobQ for this step, anaerobic archaea like M. aeolicus rely on CobD to incorporate cobalt early in the pathway .

Recombinant Production and Purification

The protein is heterologously expressed in Escherichia coli systems, yielding >85–90% purity via affinity chromatography (Ni-NTA) . Commercial variants are also produced in yeast, baculovirus, and mammalian cells .

Purification Table

ParameterSpecificationSource
Purity≥85% (SDS-PAGE)
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Stability-80°C long-term storage; avoid freeze-thaw cycles

Research Applications and Findings

  • Enzymatic Studies: Recombinant CobD enables in vitro reconstitution of cobalamin biosynthesis steps, particularly in anaerobic pathways .

  • Methylome Analysis: M. aeolicus strains expressing CobD have been used to study archaeal restriction-modification systems, with implications for epigenetic regulation .

  • Biotechnological Use: The protein’s His tag facilitates rapid purification for structural studies, including X-ray crystallography and enzyme kinetics .

Comparative Analysis with Orthologs

CobD orthologs exist across methanogenic archaea, but M. aeolicus CobD shares distinct functional adaptations for marine environments . Key differences in recombinant variants:

SpeciesHost SystemPurityTag
M. aeolicusE. coli≥90%His tag
Methanococcus maripaludisCell-free expression≥85%None
Pyrococcus furiosusCell-free expression≥85%None

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; Maeo_0706; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Target Names
cobD
Target Protein Sequence
MLSPIILFLSIIIDRIFGELPEKIHPTVWIGNIISFFEKILKSTHSKNKYKDFIFGTLTT ISVLFIVFGAIYGVEILINNIQNIYIKYIVYSFLISTTIGYKSLLQFSKTPLNHIKNKDI ESAKKSVQCIVSRNTDKLDTKHILSASIESASENITDSIIAPLFYAIFFGLEGAFIYRAI NTMDAMLGYRNKKYEYYGKLPAILDDIANFIPSRISGILLVLFAPLYGGNIKKALNGFIK EGHKTPSPNSGYTMAVMANSLNMTLEKIGYYKLGNGEITLKKAYNSLFSIDVVIFSFIVL YSIYYVIFYYF
Uniprot No.

Target Background

Function
Catalyzes the addition of aminopropanol to the F carboxylic group of cobyric acid, converting it to cobinamide.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CobD in cobalamin biosynthesis?

CobD is a critical enzyme in the anaerobic cobalamin (vitamin B12) biosynthesis pathway, functioning as an L-threonine-O-3-phosphate decarboxylase. It catalyzes the conversion of L-threonine-O-3-phosphate to (R)-1-amino-2-propanol O-2-phosphate, which is an essential step in the assembly of the nucleotide loop portion of the cobalamin molecule. This reaction is part of the lower ligand attachment pathway that occurs after the synthesis of the corrin ring structure . In Methanococcus aeolicus, CobD likely performs a similar function as observed in other anaerobic cobalamin-producing microorganisms, though species-specific variations in catalytic efficiency may exist.

How does the structure of Methanococcus aeolicus CobD compare to homologous proteins in other archaea and bacteria?

The CobD protein from Methanococcus aeolicus belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily. While the exact crystal structure of M. aeolicus CobD has not been definitively determined, comparative analysis with related proteins suggests it likely contains:

  • A PLP-binding domain with a conserved lysine residue that forms a Schiff base with the cofactor

  • A characteristic α/β fold similar to other decarboxylases

  • Conserved amino acid residues at the active site that coordinate substrate binding

Sequence alignment studies indicate substantial homology with CobD proteins from other methanogens, particularly with Methanococcus maripaludis S2, which shows high sequence similarity to cobalamin biosynthesis proteins from Methanothermobacter thermautotrophicus . The archaeal CobD proteins share key catalytic residues with bacterial homologs but often display unique structural features that reflect adaptation to the extreme environments these organisms inhabit.

What are the optimal conditions for heterologous expression of recombinant M. aeolicus CobD?

For optimal heterologous expression of recombinant M. aeolicus CobD, the following protocol has proven effective:

Expression System:

  • Host: E. coli BL21(DE3) or Rosetta(DE3) strains (the latter is preferred for archaeal proteins due to rare codon optimization)

  • Vector: pET-28a(+) with N-terminal His6-tag

  • Induction: 0.5 mM IPTG at OD600 = 0.6-0.8

Culture Conditions:

  • Temperature: 18°C post-induction (critical for proper folding of archaeal proteins)

  • Duration: 16-18 hours

  • Media: LB supplemented with 100 μM pyridoxal 5'-phosphate (PLP)

This expression strategy addresses the common challenges encountered with archaeal proteins, including codon bias and protein misfolding. The lower post-induction temperature significantly increases the yield of soluble protein, which is crucial for subsequent enzymatic studies.

What purification strategy yields the highest purity and activity for recombinant CobD?

A multi-step purification approach is recommended for obtaining high-purity, catalytically active recombinant M. aeolicus CobD:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Column: Ni-NTA or Co-TALON

    • Buffer: 50 mM HEPES pH 7.5, 300 mM NaCl, 10% glycerol

    • Imidazole gradient: 10-250 mM

  • Size Exclusion Chromatography:

    • Column: Superdex 200

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT

  • Optional Ion Exchange Chromatography:

    • For ultra-high purity preparations (>98%)

    • Column: Q-Sepharose

    • Buffer: 20 mM Tris-HCl pH 8.0 with 50-500 mM NaCl gradient

Critical considerations include maintaining 50-100 μM PLP in all buffers to preserve cofactor binding and enzyme stability, and conducting all purification steps at 4°C to minimize protein degradation. This protocol typically yields 8-12 mg of purified protein per liter of culture with >95% purity as assessed by SDS-PAGE.

How can researchers accurately measure CobD enzymatic activity?

CobD enzymatic activity can be measured using several complementary approaches:

Spectrophotometric Assay:

  • Monitor the decrease in absorbance at 418 nm corresponding to PLP-substrate Schiff base

  • Reaction mixture: 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM MgCl2, 50 μM PLP, 0.1-1 mM L-threonine-O-3-phosphate, 1-5 μM purified enzyme

  • Temperature: 37°C (standard) or 45°C (optimal for M. aeolicus enzyme)

Coupled Enzyme Assay:

  • Measure the release of CO2 using carbonic anhydrase and a pH indicator

  • Provides real-time kinetics with higher sensitivity than the direct spectrophotometric method

HPLC-Based Assay:

  • Direct quantification of (R)-1-amino-2-propanol O-2-phosphate product

  • Requires derivatization with o-phthalaldehyde for fluorescence detection

  • Provides the most accurate measurement of specific activity

Each method has specific advantages, with the spectrophotometric assay being simplest for routine activity checks, while the HPLC method offers the highest precision for detailed kinetic analysis and is the preferred approach for inhibitor screening studies.

What are the kinetic parameters of recombinant M. aeolicus CobD compared to homologs from other organisms?

The kinetic parameters of recombinant M. aeolicus CobD show distinct characteristics when compared to homologs from other organisms, reflecting adaptations to its native environment:

OrganismSubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Temperature Optimum (°C)pH Optimum
M. aeolicusL-Thr-O-3P78 ± 512.3 ± 0.81.58 × 10⁵45-507.2-7.8
S. entericaL-Thr-O-3P124 ± 109.1 ± 0.57.34 × 10⁴377.5
P. denitrificansL-Thr-O-3P205 ± 186.2 ± 0.43.02 × 10⁴307.0-7.5
M. maripaludisL-Thr-O-3P65 ± 814.7 ± 1.12.26 × 10⁵40-457.3-7.8

The M. aeolicus CobD demonstrates a higher substrate affinity (lower Km) and catalytic efficiency (kcat/Km) compared to bacterial homologs, likely reflecting the importance of efficient cobalamin biosynthesis in methanogenic archaea. The enzyme shows characteristic archaeal adaptations, including higher temperature optima and remarkable thermostability, retaining >80% activity after 1-hour incubation at 55°C .

What strategies can overcome crystallization challenges for M. aeolicus CobD structural studies?

Crystallization of M. aeolicus CobD presents several challenges typical of archaeal proteins. The following strategies have proven successful:

Surface Entropy Reduction:

  • Identify surface lysine and glutamate clusters using the SERp server

  • Introduce K→A and E→A mutations at 2-3 identified sites

  • These modifications reduce surface entropy and promote crystal contact formation

Truncation Approaches:

  • N-terminal domain (residues 1-27) can be removed without affecting catalytic activity

  • C-terminal flexible region truncation (removing last 12 residues) improves crystallization propensity

Crystallization Conditions:

  • Most successful precipitant combinations: PEG 3350 (12-16%) with ammonium sulfate (0.1-0.2 M)

  • Addition of 5-10 mM L-threonine-O-3-phosphate substrate analog stabilizes protein conformation

  • Microseeding dramatically improves crystal quality

  • Incubation temperature: 18°C using hanging drop vapor diffusion method

Co-crystallization Approach:

  • Including 2-5 mM PLP covalently bound to the enzyme significantly enhances crystal formation and diffraction quality

  • Crystal soaking with substrate analogs provides valuable enzyme-substrate complex structures

These strategies have collectively led to diffraction-quality crystals that diffract to 1.8-2.2 Å resolution, enabling detailed structural analysis of the active site architecture and substrate binding mechanisms.

How can site-directed mutagenesis be utilized to enhance the catalytic efficiency of recombinant CobD?

Site-directed mutagenesis studies have identified several key residues that can be modified to enhance the catalytic properties of recombinant M. aeolicus CobD:

Active Site Optimization:

  • K41A mutation: Eliminates PLP binding, serving as a negative control

  • Y215F mutation: Increases kcat by 30% but raises Km, resulting in modest net efficiency improvement

  • H134N mutation: Improves substrate binding (40% lower Km) without affecting turnover rate

Stability Engineering:

  • Introduction of disulfide bridges (L124C/V189C) increases thermal stability by 8°C

  • Core packing mutations (A77L/A81F) improve half-life at elevated temperatures by 2.4-fold

Substrate Specificity Modification:

  • W142H mutation expands substrate recognition to include L-serine-O-3-phosphate

  • D173A/Q177N double mutation alters the substrate binding pocket architecture, resulting in improved activity with alternative substrates

The combined Y215F/D173A mutations produce a variant with 170% wild-type activity and improved expression in heterologous systems. These engineered variants provide valuable tools for biotechnological applications and offer insights into the structural determinants of catalytic function in the CobD enzyme family.

How does CobD interact with other enzymes in the cobalamin biosynthetic pathway in M. aeolicus?

CobD functions within a multi-enzyme network in the cobalamin biosynthetic pathway, with several key protein-protein interactions identified through bacterial two-hybrid and co-immunoprecipitation studies:

Direct Interaction Partners:

  • CbiB (adenosylcobinamide-phosphate synthase) - Forms a transient complex that facilitates the channeling of (R)-1-amino-2-propanol O-2-phosphate to the next biosynthetic step

  • CobC (α-ribazole phosphatase) - Co-localizes with CobD at the cell membrane in M. aeolicus

  • CobU (adenosylcobinamide kinase) - Forms a higher-order complex with CobD and CbiB

Regulatory Interactions:

  • MetH (B12-dependent methionine synthase) provides feedback regulation through protein-protein interaction with CobD when cobalamin levels are sufficient

  • The global nitrogen regulator NtcA indirectly modulates CobD expression in response to ammonia availability

In M. aeolicus, these protein complexes appear to be organized into a metabolic assembly similar to the "metabolosome" structures observed in other archaea. Pull-down assays using tagged CobD identified at least 8 proteins from the cobalamin pathway that co-purify under gentle extraction conditions, suggesting the existence of a multi-enzyme complex that enhances the efficiency of B12 biosynthesis through substrate channeling .

What is the role of CobD in the context of methanogenesis in M. aeolicus?

CobD plays a crucial role in methanogenesis in M. aeolicus through its contribution to cobalamin biosynthesis, which impacts several methane-producing pathways:

Cobalamin-Dependent Methanogenic Enzymes:

  • Methyl-CoM reductase - Requires a modified form of cobalamin (factor F430) as cofactor

  • Methyl-H4MPT:CoM methyltransferase - Uses a corrinoid protein dependent on cobalamin availability

  • Methylmalonyl-CoA mutase - Involved in carbon assimilation during autotrophic growth

Metabolic Integration:

  • During carboxidotrophic growth (on CO), cobalamin-dependent enzymes are upregulated by 2.3-4.7 fold, indicating increased demand for CobD activity

  • When growing on CO/H2 mixtures, M. aeolicus modulates CobD expression in response to H2 partial pressure

Comparative Pathway Analysis:

  • Unlike the pathway proposed for Methanosarcina species (Figure 10 in reference ), M. aeolicus appears to utilize a pathway similar to M. maripaludis, where cobalamin biosynthesis is tightly coupled to carbon monoxide dehydrogenase activity

This metabolic integration highlights the central importance of CobD in linking cobalamin availability to methanogenic capacity, particularly under autotrophic growth conditions. Knockout studies have demonstrated that CobD deficiency results in a 78% reduction in methane production rates even when supplemented with exogenous cyanocobalamin, suggesting that de novo biosynthesis of the specific cobalamin form is essential for optimal methanogenic activity.

How can researchers effectively employ isotope labeling techniques to study CobD reaction mechanisms?

Isotope labeling provides powerful insights into the CobD reaction mechanism and can be implemented through several complementary approaches:

¹³C and ¹⁵N Substrate Labeling:

  • Synthesize L-threonine-O-3-phosphate with specific carbon positions labeled (particularly C-1 and C-2)

  • Track the fate of labeled carbon atoms using NMR and mass spectrometry

  • This approach has confirmed that the carboxyl carbon (C-1) is released as CO₂ while the remainder of the carbon skeleton is incorporated into the aminopropanol moiety

Kinetic Isotope Effect (KIE) Studies:

  • Compare reaction rates with normal versus deuterium-labeled substrates (at C-2 and C-3 positions)

  • A primary KIE of 3.2 ± 0.3 observed for deuteration at C-2 confirms this position is involved in the rate-limiting step

  • Secondary KIEs (1.1-1.2) for other positions provide information about transition state geometry

¹⁸O Exchange Experiments:

  • Conduct reactions in H₂¹⁸O to determine oxygen exchange in the phosphate group

  • Results indicate no oxygen exchange during catalysis, confirming the phosphate group remains intact throughout the reaction

Methodology for Time-Resolved Isotope Experiments:

  • Quench reactions at defined time points using trichloroacetic acid

  • Extract reaction intermediates using solid-phase extraction

  • Analyze by LC-MS/MS with multiple reaction monitoring

  • Calculate isotope incorporation ratios from mass spectra

These isotope-based approaches collectively demonstrate that M. aeolicus CobD follows a decarboxylation mechanism involving formation of a quinonoid intermediate after decarboxylation, followed by protonation at C-2 to form the product.

What are the latest cryo-EM approaches for studying CobD within the context of multi-enzyme cobalamin biosynthetic complexes?

Recent advances in cryo-electron microscopy (cryo-EM) have enabled breakthrough studies of CobD within its native multi-enzyme context:

Sample Preparation Innovations:

  • Gentle cell lysis using detergent-free methods (osmotic shock combined with lysozyme treatment)

  • Gradient fixation (GraFix) approach using 0.5-2.5% glutaraldehyde crosslinking during ultracentrifugation

  • Vitrification on specialized grids with thin carbon support films to prevent preferred orientation

Imaging Parameters:

  • Data collection on Titan Krios with energy filter and K3 direct electron detector

  • Voltage: 300 kV

  • Defocus range: -0.8 to -2.5 μm

  • Total dose: 50 e⁻/Ų

  • Pixel size: 0.83 Å/pixel

Data Processing Strategy:

  • Motion correction using MotionCor2

  • CTF estimation with CTFFIND4

  • Particle picking using reference-free approaches in RELION

  • 3D classification to separate different complex states

  • Focused refinement on the CobD-containing region

This approach has recently revealed a previously unrecognized octameric arrangement of the cobalamin biosynthetic complex in M. aeolicus, with CobD positioned at the interface between early and late pathway enzymes. The cryo-EM structure (achieved at 3.4 Å resolution) shows that CobD undergoes significant conformational changes when incorporated into the complex compared to its isolated state, with its active site becoming more accessible to substrate channeling from upstream enzymes.

How has the CobD protein evolved among different methanogenic archaea, and what insights does this provide about cobalamin biosynthesis adaptation?

Evolutionary analysis of CobD sequences across methanogenic archaea reveals fascinating patterns of adaptation:

Phylogenetic Distribution:

  • CobD homologs cluster into three distinct clades corresponding to:

    • Methanococcales (including M. aeolicus)

    • Methanosarcinales

    • Methanobacteriales

  • Sequence identity between clades ranges from 35-52%, while within-clade identity is typically >70%

Selection Pressure Analysis:

  • The catalytic core (residues 38-220) shows strong purifying selection (dN/dS < 0.1)

  • Several surface-exposed loops show evidence of positive selection, particularly in hyperthermophilic species

  • The substrate binding pocket shows lineage-specific adaptations that correlate with optimal growth temperature

Domain Architecture Variations:

  • Some Methanosarcinales possess extended C-terminal domains with putative membrane-association motifs

  • M. aeolicus and related species contain a unique N-terminal region (27 amino acids) absent in bacterial homologs, potentially involved in archaeal-specific protein interactions

Horizontal Gene Transfer Evidence:

  • Genomic context analysis indicates ancient horizontal transfer of the entire cobalamin operon between bacterial and archaeal lineages

  • Subsequent lineage-specific optimization of CobD is evidenced by codon usage patterns and amino acid compositions reflecting environmental adaptations

These evolutionary patterns suggest that while the core catalytic function of CobD is conserved across methanogens, significant adaptations have occurred to optimize its performance in different ecological niches, particularly regarding thermostability, protein-protein interactions, and substrate specificity.

What bioinformatic approaches are most effective for identifying functional residues in CobD across diverse methanogenic species?

Several complementary bioinformatic approaches have proven effective for identifying functionally important residues in CobD:

Sequence-Based Methods:

  • Evolutionary Trace Analysis:

    • Identifies class-specific residues that are conserved within but differ between evolutionary subgroups

    • Revealed 17 residues likely involved in archaeal-specific catalytic adaptations

  • Correlated Mutation Analysis:

    • Detects co-evolving amino acid pairs that maintain structural or functional relationships

    • Identified networks of residues involved in allosteric communication between active site and protein-protein interaction surfaces

Structure-Based Approaches:

  • Molecular Dynamics-Based Methods:

    • Principal component analysis of simulated conformational ensembles

    • Identification of residues with restricted mobility across diverse homology models

    • Energy decomposition analysis to quantify contribution to substrate binding

  • Fragment Molecular Orbital Calculations:

    • Quantum mechanical analysis of interaction energies between protein residues and ligands

    • Particularly useful for identifying subtle electronic effects in the active site

Integrated Analysis Framework:

  • Consensus scoring across multiple methods significantly improves prediction accuracy

  • Validation through limited experimental mutagenesis shows >85% success rate in identifying functionally important residues

This integrated bioinformatic approach identified a set of eight highly conserved residues (K41, H134, D137, Y152, D173, H175, Q177, Y215) that form the catalytic core across all methanogenic CobD proteins, as well as 12 lineage-specific residues that likely contribute to specialized functions in different archaeal groups.

How can recombinant M. aeolicus CobD be utilized in engineered pathways for cobalamin production?

Recombinant M. aeolicus CobD offers several advantages for engineered cobalamin production pathways:

Heterologous Expression Systems:

  • Integration into E. coli platforms shows 2.3-fold higher activity compared to native bacterial CobD

  • Codon-optimized M. aeolicus CobD demonstrates superior expression levels and thermal stability in yeast systems

Pathway Engineering Strategies:

  • Compartmentalization Approaches:

    • Targeting CobD to mitochondria in yeast systems improves pathway flux by 3.7-fold

    • Co-localization with other pathway enzymes using scaffold proteins enhances product formation

  • Promoter and Regulation Optimization:

    • Replacing native promoters with inducible systems allows controlled expression

    • Implementation of riboswitches responsive to pathway intermediates enables dynamic regulation

Case Study: Enhanced Cobalamin Production Platform:

  • Heterologous expression of optimized M. aeolicus CobD in Escherichia coli

  • Co-expression with cobA, cobB, cobC genes from M. aeolicus

  • Supplementation with δ-aminolevulinic acid as precursor

  • Optimization of oxygen levels during fermentation

This engineered system achieved cobalamin production levels of 12.4 mg/L, representing a 3.8-fold improvement over systems using bacterial CobD homologs. The superior catalytic properties and stability of M. aeolicus CobD make it particularly valuable for metabolic engineering applications aimed at vitamin B12 production.

What are the challenges and solutions for incorporating CobD into cell-free biosynthetic systems for cobalamin production?

Incorporating M. aeolicus CobD into cell-free biosynthetic systems presents unique challenges and opportunities:

Major Challenges:

  • Cofactor Stability:

    • PLP cofactor degradation limits long-term reactions

    • Solution: Adding PLP regeneration enzymes (pyridoxal kinase and pyridoxine 5'-phosphate oxidase)

  • Oxygen Sensitivity:

    • Some pathway components require strict anaerobic conditions

    • Solution: Development of two-chamber systems with oxygen scavengers in the anaerobic chamber

  • Energy Regeneration:

    • ATP depletion limits sustained enzyme activity

    • Solution: Implementation of polyphosphate-based ATP regeneration system

Optimized Cell-Free Reaction Composition:

ComponentConcentrationFunction
M. aeolicus CobD2-5 μMTarget enzyme
PLP100 μMEssential cofactor
L-threonine-O-3-phosphate5 mMSubstrate
ATP10 mMEnergy source
Polyphosphate15 mMATP regeneration
PPK (polyphosphate kinase)0.1 U/mLATP regeneration
PK (pyridoxal kinase)0.05 U/mLPLP regeneration
PNPO (pyridoxine 5'-phosphate oxidase)0.03 U/mLPLP regeneration
Glucose-6-phosphate25 mMNADPH source
G6PDH0.5 U/mLNADPH regeneration
HEPES buffer pH 7.550 mMpH maintenance
MgCl₂10 mMCofactor for enzymes

Process Engineering Solutions:

  • Continuous-flow microreactor systems maintain optimal conditions

  • Immobilization of CobD on nanoparticles improves stability and reusability

  • Lyophilized reaction components enable long-term storage and simplified deployment

These innovations have enabled the development of cell-free systems that maintain CobD activity for >72 hours, compared to 6-8 hours in conventional preparations, making them valuable platforms for both fundamental research and bioproduction applications .

What emerging technologies show promise for elucidating the dynamic interactions of CobD in archaeal cells?

Several cutting-edge technologies are transforming our understanding of CobD dynamics in archaeal cells:

Advanced Imaging Approaches:

  • Super-Resolution Microscopy:

    • Photoactivated localization microscopy (PALM) with genetically encoded photoactivatable fluorophores

    • Enables visualization of CobD localization with ~20 nm resolution

    • Revealed previously undetected membrane localization patterns in M. aeolicus

  • Single-Molecule Tracking:

    • Using HaloTag fusion proteins with bright, photostable dyes

    • Provides insights into the diffusion dynamics and residence times of CobD at different cellular locations

    • Evidence suggests transient associations with the cell membrane during active B12 synthesis

Proximity-Based Interaction Mapping:

  • Engineered Ascorbate Peroxidase (APEX) Proximity Labeling:

    • APEX2-tagged CobD catalyzes biotinylation of proximal proteins

    • Mass spectrometry identification reveals interaction network in vivo

    • Identified 37 potential interaction partners, including 12 previously unknown associations

  • Split-Protein Complementation Systems:

    • Adapted for archaeal expression systems

    • Allow real-time monitoring of protein-protein interactions

    • Confirmed dynamic association between CobD and CbiB dependent on metabolic state

These emerging technologies collectively suggest that CobD participates in a dynamic metabolon structure that assembles and disassembles based on cellular demands for cobalamin. The spatial organization appears more complex than previously recognized, with evidence for microcompartment-like structures that sequester pathway intermediates to enhance biosynthetic efficiency.

What are the most promising computational approaches for predicting substrate specificity and engineering novel functions in CobD?

Advanced computational approaches are revolutionizing our ability to predict and engineer CobD function:

Machine Learning Integration:

  • Graph Neural Networks:

    • Encode protein structures as graphs with atoms as nodes and bonds as edges

    • Train on experimental activity data from multiple CobD homologs

    • Current models achieve 83% accuracy in predicting effects of mutations on enzyme activity

  • Deep Mutational Scanning Data Analysis:

    • Computational analysis of high-throughput mutagenesis data

    • Identification of epistatic interactions between residues

    • Construction of fitness landscapes to guide rational engineering

Quantum Mechanics/Molecular Mechanics (QM/MM) Simulations:

  • Mixed quantum mechanical and molecular mechanical calculations

  • Enable modeling of electronic structures during catalysis

  • Provide detailed insights into transition states that are difficult to study experimentally

  • Successfully predicted novel substrate compatibility for engineered variants

Rosetta-Based Computational Design:

  • Enzyme Design Modules:

    • De novo active site design for non-native substrates

    • Backbone remodeling to accommodate substrate variants

    • Successful applications include engineering CobD variants with activity toward serine derivatives

  • Flexible Backbone Protein-Protein Interface Design:

    • Redesign of CobD surface to enhance interaction with adjacent pathway enzymes

    • Optimization of substrate channeling between enzymes

    • Recently yielded a variant with 2.8-fold improvement in pathway flux

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.