Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Recombinant Production

The recombinant mtrB protein is expressed in E. coli as a full-length, His-tagged construct (1–108 amino acids) with a purity >90% as determined by SDS-PAGE . Key specifications include:

ParameterDetails
Source OrganismMethanococcus aeolicus (archaeal methanogen)
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull-length (108 amino acids)
Storage BufferTris/PBS-based buffer, pH 8.0, 6% trehalose
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) for stability
UniProt IDA6UWH6
AA SequenceMELVKICPEIGIVMDVDTGIVAEMRKDILVVDLNPIKEEINKLETLSKAFENSLDPRSAP LKAYDGRDNIYSVGGLFQSAFFGFWISLSILTLGLILVIGLYPKLIGL

The protein is lyophilized and stored at -20°C/-80°C, with aliquoting recommended to avoid freeze-thaw cycles .

Functional Role in Methanogenesis

mtrB is a component of the Mtr complex, a sodium-translocating methyltransferase system that couples methyl-group transfer to energy conservation in methanogens . This complex operates in the methanogenic pathway, converting methyl-tetrahydromethanopterin (CH₃-H₄MPT) and coenzyme M (CoM) into methyl-CoM and tetrahydromethanopterin (H₄MPT) .

Key Functional Partners

The Mtr complex comprises eight subunits (A–H), with mtrB interacting closely with:

SubunitRoleInteraction Score
mtrABinds corrinoid cofactor; catalyzes methyl transfer0.999
mtrDStructural component; stabilizes subunit interactions0.999
mtrEEnergy transduction; sodium-ion translocation0.999
mtrHFacilitates methyl-group transfer between methyl-H₄MPT and MtrA0.996
mtrCRegulatory and catalytic functionsPredicted

These interactions are critical for the enzyme’s activity in maintaining redox balance and generating a proton/sodium motive force .

Biotechnological Relevance

The recombinant mtrB protein enables:

  • Structural studies: X-ray crystallography or cryo-EM to map interactions within the Mtr complex.

  • Enzymatic assays: Measurement of methyltransferase activity under varying pH, temperature, or ionic conditions.

  • Bioengineering: Development of synthetic methanogenesis pathways for biogas production or carbon sequestration.

Experimental Handling

RecommendationDetails
ReconstitutionUse deionized water; avoid repeated freeze-thaw cycles .
StabilityWorking aliquots: 4°C (≤1 week); long-term storage: -20°C/-80°C .
Buffer CompatibilityOptimal activity in Tris/PBS buffer; avoid reducing agents (e.g., DTT).

Genomic and Evolutionary Context

The mtrB gene (locus Maeo_1272) is part of the mtrEDCBAFGH operon, which is conserved across methanogenic archaea . In Methanococcus aeolicus, this operon is flanked by genes encoding other methyltransferases and restriction-modification systems, suggesting a role in epigenetic regulation and genome defense .

Comparative Analysis with Homologs

Recombinant mtrB homologs from related methanogens (e.g., Methanothermobacter marburgensis, Methanococcus vannielii) share structural and functional similarities . These homologs are often used to study evolutionary adaptations in thermophilic or psychrophilic environments.

Challenges and Future Directions

  • Stability: Recombinant mtrB requires careful handling due to its sensitivity to temperature and proteolysis .

  • Functional Reconstitution: Full activity of the Mtr complex in vitro requires co-expression of all subunits, complicating biochemical studies .

  • Biotechnological Potential: Engineering mtrB for enhanced thermostability or substrate specificity could improve methanogenesis efficiency in industrial settings.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrB; Maeo_1272; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Target Names
mtrB
Target Protein Sequence
MELVKICPEIGIVMDVDTGIVAEMRKDILVVDLNPIKEEINKLETLSKAFENSLDPRSAP LKAYDGRDNIYSVGGLFQSAFFGFWISLSILTLGLILVIGLYPKLIGL
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process is energy-conserving and involves sodium-ion translocation.
Database Links
Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How does mtrB relate to other enzyme complexes in the methanogenesis pathway?

The methanogenesis pathway in archaea involves several interconnected enzyme complexes that collectively catalyze the reduction of carbon dioxide or other C1 compounds to methane. Tetrahydromethanopterin S-methyltransferase (containing mtrB) functions upstream of the terminal enzyme Methyl-coenzyme M reductase (MCR), which catalyzes the final reduction step in methanogenesis .

The relationship between these enzyme complexes can be understood within the broader context of the methanogenic pathway:

  • Initial activation of carbon dioxide or other C1 substrates

  • Reduction and transfer via tetrahydromethanopterin carriers

  • Tetrahydromethanopterin S-methyltransferase complex action (including mtrB)

  • Generation of methyl-coenzyme M

  • Final reduction by MCR complex to produce methane

Notably, both enzyme complexes have evolved specialized features for functioning in strictly anaerobic environments. The MCR complex consists of three subunits (McrA, McrB, McrG) in an (αβγ)₂ configuration, with accessory proteins McrC and McrD that play roles in assembly . Similarly, the mtr complex includes multiple subunits that must assemble correctly for function. These methanogenic enzyme complexes represent ancient biochemical systems that may have co-evolved with Earth's redox landscape .

What expression and purification considerations are important for working with recombinant mtrB?

Working with recombinant mtrB presents several technical challenges that require careful consideration during expression and purification. The protein information from product specifications provides important baseline parameters for handling this protein :

Storage and Stability Considerations:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Storage temperature: -20°C for regular storage; -80°C recommended for extended storage

  • Working aliquots should be stored at 4°C for no more than one week

  • Repeated freeze-thaw cycles should be avoided to maintain protein integrity

Expression Challenges:
The expression of archaeal proteins in heterologous systems presents specific challenges, particularly for membrane-associated proteins like mtrB. The successful expression of related methanogenic proteins has been reported using Methanococcus maripaludis as a host organism, which provides the appropriate cellular environment for proper folding and assembly . When expressing mtrB, researchers should consider:

  • Host selection: Archaeal expression hosts may be preferable to bacterial systems

  • Oxygen exposure: Strict anaerobic conditions during all expression and purification steps

  • Complex assembly: Co-expression with other subunits may be necessary for proper folding

  • Post-translational modifications: Expression systems should support relevant modifications

These considerations align with findings from studies on MCR expression, which demonstrate that "Methanogenic and ANME MCRs are successfully expressed and assembled in M. maripaludis" .

What experimental design approaches are most effective for investigating mtrB function?

Investigating mtrB function requires robust experimental design that accounts for the protein's biochemical properties and functional context. Following established experimental design principles , researchers should implement a systematic approach that includes:

1. Variable Definition and Control:

  • Independent variables: Expression conditions, buffer composition, substrate concentrations

  • Dependent variables: Enzyme activity, complex formation efficiency, stability metrics

  • Controlled variables: Protein purity, assay conditions, anaerobic environment

2. Hypothesis Formulation:
Clear, testable hypotheses about mtrB function should be developed. For example:

  • H₀: "Recombinant mtrB exhibits equivalent substrate binding affinity compared to native protein"

  • H₁: "Recombinant mtrB exhibits reduced substrate binding affinity compared to native protein"

3. Experimental Treatment Design:

Treatment VariableLevelsMeasurementControl Condition
Temperature20°C, 37°C, 60°CActivity, stabilityOptimal growth temperature
pH6.0, 7.0, 8.0Reaction rate, complex formationPhysiological pH
Salt concentration0.1M, 0.5M, 1.0MProtein solubility, activityNative cytoplasmic concentration
Redox potential-300mV, -400mV, -500mVEnzyme activityStandard reducing conditions

4. Control Experiments:

  • Negative controls: Inactive mutants, reactions without substrates

  • Positive controls: Native enzyme preparation when available

  • System validation: Activity of reconstituted complete complex

5. Statistical Analysis:

  • Sample size determination via power analysis

  • Multiple comparison corrections for complex experimental designs

  • Effect size calculations to assess biological significance

This experimental approach aligns with principles outlined for designed experiments , ensuring that causal relationships regarding mtrB function can be rigorously established.

How can researchers effectively address mtrB oxygen sensitivity challenges?

The extreme oxygen sensitivity of methanogenic enzymes presents a significant methodological challenge for researchers . Effective strategies to address this limitation when working with mtrB include:

1. Anaerobic Laboratory Infrastructure:

  • Dedicated anaerobic chambers with controlled atmosphere (N₂/H₂/CO₂)

  • Integrated airlock systems for material transfer without oxygen exposure

  • Continuous monitoring of oxygen levels using specialized detectors

  • Oxygen-scavenging catalysts and reducing agents in working environment

2. Buffer and Media Considerations:

  • Pre-reduction of all solutions using reducing agents (e.g., sodium dithionite, titanium citrate)

  • Oxygen indicators (e.g., resazurin) to visually monitor redox status

  • Degassing protocols using oxygen-free gas sparging

  • Addition of oxygen-consuming enzyme systems for additional protection

3. Sample Handling Protocol:

StageAnaerobic RequirementMethodologyQuality Control
Cell harvestModerateRapid processing in gas-purged vesselsResazurin indicator
LysisHighPressure cell disruption in anaerobic chamberActivity preservation check
PurificationVery highFPLC with degassed buffers in anaerobic environmentActivity assays at each step
StorageModerateGas-purged vials with reducing agentsStability testing over time
Activity assaysCriticalSealed vessels with continuous redox monitoringControl reactions with oxygen exposure

4. Activity Measurement Approaches:

  • Coupled enzyme assays with oxygen-scavenging components

  • Sealed reaction vessels with oxygen-free headspace

  • Rapid workflow with minimized sample manipulation

  • Correction factors for any oxygen exposure during measurement

These approaches are supported by the protocols developed for handling related methanogenic enzymes, which note that successful work requires "extremely oxygen sensitive and requires a complex enzyme system for its reductive activation" .

What are the most effective methods for studying protein-protein interactions involving mtrB?

Investigating protein-protein interactions involving mtrB requires specialized approaches due to its membrane association and oxygen sensitivity. Based on strategies employed for related methanogenic proteins , effective methodologies include:

1. In Vivo Interaction Studies:

  • Co-expression of tagged subunits in archaeal hosts

  • Pull-down assays using affinity-tagged mtrB under anaerobic conditions

  • Split-protein complementation assays adapted for membrane proteins

  • FRET-based approaches using fluorescent protein fusions

2. Reconstitution Experiments:

  • Systematic assembly of purified subunits under controlled conditions

  • Activity measurements with different subunit combinations

  • Order-of-addition experiments to determine assembly pathway

  • Cross-linking studies to capture transient interactions

3. Structural Biology Approaches:

  • Cryo-electron microscopy of intact complexes

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Cross-linking coupled with mass spectrometry (XL-MS) to identify interaction sites

  • Native mass spectrometry to determine complex stoichiometry

4. Assembly Pathway Analysis:
The assembly order of complex subunits is likely critical, as demonstrated for the MCR complex where "McrA and B forms an initial complex, and McrG is the last subunit added to the McrAB complex" . Similar assembly dynamics might exist for the mtr complex and could be studied using pulse-chase experiments and time-resolved proteomics.

5. Data Integration Framework:

MethodStrengthLimitationData Integration
Co-immunoprecipitationCaptures native interactionsRequires specific antibodiesIdentifies binding partners
CrosslinkingMaps interaction interfacesMay capture non-specific interactionsDefines spatial relationships
FRET analysisMeasures distances between componentsRequires fluorescent labelingProvides dynamic information
ReconstitutionTests functional interactionsRequires purified componentsConfirms biological relevance

These complementary approaches provide a comprehensive framework for understanding the interaction landscape of mtrB within its functional complex.

How does experimental methodology influence comparative analysis of wild-type and mutant mtrB?

When designing experiments to compare wild-type and mutant forms of mtrB, methodological considerations significantly impact the validity and interpretation of results. Drawing on experimental design principles and assessment techniques , researchers should implement:

1. Mutation Strategy Considerations:

  • Structure-guided mutations targeting predicted functional residues

  • Evolutionary conservation analysis to identify critical residues

  • Scanning mutagenesis of interaction interfaces

  • Mutations affecting potential post-translational modification sites

2. Expression System Standardization:

  • Identical expression conditions for all variants

  • Verification of protein expression levels via quantitative Western blot

  • Consistent purification protocols to minimize variability

  • Parallel processing of all variants to ensure comparability

3. Multi-dimensional Functional Assessment:

Functional ParameterMeasurement TechniqueKey ComparisonsControls
Enzymatic activitySpectrophotometric assaysKm, Vmax, kcat/KmKnown active/inactive mutants
Protein stabilityDifferential scanning fluorimetryTm, unfolding cooperativityStorage time controls
Complex formationSize exclusion chromatographyAssembly efficiency, stoichiometryIndividual subunits alone
Membrane integrationMembrane fractionationLocalization patternSoluble protein controls
  • Targeted assays (equivalent to MTF) may overestimate specific functional parameters

  • Open-ended functional assays (equivalent to FR) may better reveal unexpected properties

  • Complementary assessment approaches provide the most comprehensive understanding

5. Statistical Rigor and Reporting:

  • Power analysis to determine required replication

  • Appropriate statistical tests for hypothesis validation

  • Effect size calculations to assess biological significance

  • Complete reporting of all experimental conditions and controls

This methodological framework ensures that comparisons between wild-type and mutant mtrB yield reliable, interpretable data that accurately reflects the biological impact of the mutations.

What analytical techniques are most appropriate for measuring mtrB-mediated enzymatic activity?

Measuring the enzymatic activity of mtrB as part of the Tetrahydromethanopterin S-methyltransferase complex requires specialized analytical techniques that account for its biochemical properties and function. Recommended approaches include:

1. Spectrophotometric Methods:

  • Direct monitoring of cofactor oxidation/reduction at appropriate wavelengths

  • Coupled enzyme assays linking methyl transfer to measurable chromogenic reactions

  • Kinetic measurements under varying substrate concentrations for Michaelis-Menten analysis

2. Radioisotope-Based Approaches:

  • ¹⁴C-labeled methyl donors to track methyl transfer reactions

  • Scintillation counting for quantitative measurement of reaction progress

  • Separation of labeled products by thin-layer chromatography or HPLC

3. Mass Spectrometry Techniques:

  • Multiple reaction monitoring (MRM) for specific methyl transfer detection

  • Isotope labeling to track methyl group movement during catalysis

  • Time-course analysis of substrate depletion and product formation

4. Gas Chromatography Applications:

  • Measurement of pathway completion via methane quantification

  • Analysis of reaction intermediates through derivatization approaches

  • Coupled GC-MS for product identification and quantification

5. Activity Assay Optimization Table:

ParameterOptimization RangeConsiderationQuality Control
Temperature30-65°CNative environment temperatureActivity stability over time
pH6.5-8.0Buffer compatibility with assaypH stability during reaction
Salt concentration0.1-0.5MEffect on protein stabilityConsistent ionic strength
Substrate concentration0.1-10× KmPrevents substrate limitationLinearity of response
Enzyme concentrationVariableEnsures linear reaction ratesTime-dependent activity

All assays must be performed under strictly anaerobic conditions due to the extreme oxygen sensitivity of methanogenic enzymes . Specialized anaerobic chambers or sealed reaction vessels with oxygen scavengers are essential for obtaining reliable activity measurements.

What approaches can be used to investigate the effects of post-translational modifications on mtrB function?

Post-translational modifications (PTMs) often play crucial roles in the function of methanogenic enzymes. Based on findings from related proteins , investigating PTMs in mtrB requires multifaceted approaches:

1. PTM Identification Strategies:

  • High-resolution mass spectrometry to map modification sites

  • Comparison of PTM patterns between native and recombinant protein

  • Enrichment methods for specific modifications (e.g., methylated residues)

  • Site-specific antibodies against known modifications

2. Modification-Function Correlation:

  • Site-directed mutagenesis of modified residues

  • Activity comparison between modified and unmodified forms

  • Expression in systems with and without modification machinery

  • Structural analysis of modification impact on protein conformation

3. PTM Enzyme Identification:
The enzymes responsible for modifications in methanogenic proteins have been partially characterized. For example, "Mmp10 from Methanosarcina acetivorans catalyzes the methylation of arginine in a 13-amino acid peptide of the McrA subunit in the presence of cobalamin" . Similar approaches could identify enzymes modifying mtrB:

  • Co-expression with candidate modification enzymes

  • In vitro modification assays with purified enzymes

  • Genetic knockout studies in native hosts

  • Correlation of modification patterns with enzyme expression levels

4. Comparative Analysis Framework:

Modification TypeDetection MethodFunctional AssessmentReference Data
MethylationMass spectrometryActivity with/without methylation"methylation of arginine was absent in McrA...rates of methanogenesis were reduced by 40 to 60%"
ThiolationChemical labeling, MSRedox sensitivity comparison"Two genes ycaO and tfuA were identified to be responsible for...thioglycine"
Other PTMsSpectroscopic methodsStability and activity measurements"The methylation of cysteine...might play a role in adaption to mesophilic conditions"

5. Expression System Considerations:
The choice of expression system significantly impacts PTM patterns. For archaeal proteins, "expression in methanogenic hosts (like M. maripaludis mentioned in result ) may be required for proper folding and assembly" . This approach ensures the presence of the native modification machinery.

These systematic approaches provide a comprehensive framework for understanding how PTMs influence mtrB structure, stability, and function within the methanogenic pathway.

How can researchers effectively compare data from different experimental designs when studying mtrB?

Comparing data from different experimental designs presents significant challenges in mtrB research due to methodological variations. Based on assessment research principles and experimental design guidelines , researchers should implement the following strategies:

1. Data Normalization Approaches:

  • Internal reference standards across experiments

  • Percent of maximal activity rather than absolute values

  • Z-score normalization for cross-laboratory comparisons

  • Benchmark against well-characterized control proteins

2. Metadata Documentation Requirements:

  • Complete experimental conditions (temperature, pH, redox potential)

  • Detailed protein preparation methods

  • Precise assay protocols including component concentrations

  • Control experiment results for context

3. Statistical Framework for Comparison:

  • Meta-analysis techniques for aggregating data across studies

  • Heterogeneity assessment using I² statistics

  • Random-effects models to account for between-study variance

  • Effect size calculation for standardized comparison

4. Experimental Design Comparison Matrix:

5. Standardization Recommendations:
Drawing from molecular tumor board research principles, "standardized evaluation criteria to enable robust comparisons across studies" are essential. For mtrB research, this includes:

  • Standard activity assay conditions

  • Reference protein preparations

  • Agreed-upon data reporting formats

  • Common statistical approaches

Implementation of these strategies aligns with the observation that "we recommend discussing a consensus for assessing relevant parameters that should be standardized between groups. This approach could tremendously improve research, including comparing therapies between cohorts, regional areas, or available regimens" .

What considerations are important when designing MTF (Multiple-True-False) questions to assess knowledge about mtrB?

Designing effective Multiple-True-False (MTF) questions for assessing knowledge about mtrB requires understanding both the biochemical complexity of the protein and the assessment format limitations. Based on research into question formats , important considerations include:

1. Statement Construction Principles:

  • Focus on specific conceptions about mtrB function

  • Include both established facts and common misconceptions

  • Address various aspects (structure, function, interactions)

  • Ensure precise, unambiguous language

2. Balance and Scope Considerations:

  • "The MTF section had a roughly even balance of questions with one, two, or three true statements to discourage students from biasing their question responses toward a particular pattern"

  • Cover fundamental knowledge and advanced concepts

  • Include statements addressing methodological aspects

  • Incorporate current research findings

3. Example MTF Question Set:

Question: "Regarding Methanococcus aeolicus mtrB, indicate which statements are TRUE or FALSE:"

a) mtrB functions as part of a multi-subunit methyltransferase complex in methanogenesis.
b) The protein can be expressed with full functionality in standard E. coli expression systems under aerobic conditions.
c) The amino acid sequence indicates the presence of hydrophobic regions consistent with membrane association.
d) Post-translational modifications have no significant impact on mtrB activity.

4. Assessment Format Considerations:
The research on assessment formats indicates that "MTF questions reveal a high prevalence of students with mixed (correct and incorrect) conceptions, while FR questions reveal a high prevalence of students with partial (correct and unclear) conceptions" . This suggests:

5. Validation and Refinement Process:

  • Pilot testing with subject matter experts

  • Item analysis for discrimination and difficulty

  • Revision based on response patterns

  • Cross-validation with other assessment formats

This approach to MTF question design ensures comprehensive assessment of knowledge about mtrB while recognizing the inherent limitations of the format, as noted in the research that these questions may "obscure nuances in student thinking and may overestimate the frequency of particular conceptions" .

What emerging technologies show promise for advancing mtrB research?

Recent technological developments offer exciting opportunities to overcome traditional challenges in studying mtrB and related methanogenic enzymes. These emerging approaches include:

1. Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for membrane protein complexes without crystallization

  • Integrative structural biology combining multiple data sources

  • Time-resolved structural studies capturing dynamic states

  • In-cell structural analysis under native conditions

2. Genetic System Advancements:
Building on the observation that "Methanogenic and ANME MCRs are successfully expressed and assembled in M. maripaludis" , new genetic tools include:

  • CRISPR-Cas9 systems adapted for archaeal organisms

  • Inducible promoter systems for controlled expression

  • Reporter gene fusions for localization studies

  • High-throughput mutagenesis platforms

3. Single-Molecule Approaches:

  • Fluorescence resonance energy transfer (FRET) for conformational dynamics

  • Optical tweezers for mechanical property measurements

  • Single-molecule enzymology for heterogeneity assessment

  • Super-resolution microscopy for in situ localization

4. Computational Methods Development:

  • Molecular dynamics simulations of membrane-embedded complexes

  • Machine learning algorithms for function prediction

  • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism elucidation

  • Systems biology models of methanogenesis pathways

5. Microfluidic and High-Throughput Methods:

  • Droplet microfluidics for single-cell analysis

  • Miniaturized anaerobic cultivation systems

  • Automated activity assay platforms

  • Massively parallel protein variant analysis

These technological advances promise to overcome the traditional limitations in studying methanogenic enzymes, including their oxygen sensitivity and complex assembly requirements. By enabling more precise and higher-throughput analyses, these approaches may accelerate our understanding of mtrB's role in methanogenesis and potentially inform biotechnological applications.

How might understanding mtrB contribute to broader research on methanogenesis and climate change?

Research on mtrB and related methanogenic enzymes has significant implications for understanding global methane cycling and developing climate change mitigation strategies. These connections include:

1. Environmental Methanogenesis Understanding:

  • Quantifying enzymatic contributions to global methane production

  • Identifying environmental factors affecting methanogenic activity

  • Mapping the distribution of methanogenic organisms across ecosystems

  • Modeling methane production under changing climate conditions

2. Phylogenetic and Evolutionary Insights:
The evidence for "horizontal and vertical transmission" of related systems suggests that studying mtrB evolution can reveal:

  • Ancient adaptations to Earth's changing atmosphere

  • Evolutionary relationships among methanogenic lineages

  • Horizontal gene transfer patterns in archaeal communities

  • Co-evolution of methanogenesis with other biogeochemical processes

3. Climate Change Mitigation Applications:

  • Enzyme inhibitor development for methane emission reduction

  • Biofilter design using engineered methanotrophic organisms

  • Carbon capture technologies inspired by methanogenic pathways

  • Monitoring tools based on methanogenic enzyme detection

4. Interaction with Other Biogeochemical Cycles:

  • Coupling of carbon and sulfur cycles through methanogenesis

  • Interplay between methanogenesis and methane oxidation

  • Competition between methanogenic and sulfate-reducing pathways

  • Impact of nitrogen availability on methanogenic enzyme expression

5. Biotechnological Applications:
Understanding mtrB and related enzymes could inform:

  • Biofuel production through controlled methanogenesis

  • Waste treatment technologies harnessing methanogenic activity

  • Biomethane upgrading processes

  • Specialized catalyst design inspired by methanogenic enzymes

These broader implications highlight the importance of fundamental research on mtrB beyond its immediate biochemical context. As noted regarding related systems, this research "demonstrates that this capacity for EET has broad relevance to a diversity of taxa and the biogeochemical cycles they drive, and lays the foundation for further studies to shed light on how this mechanism may have coevolved with Earth's redox landscape" .

What are the key challenges and opportunities in mtrB research?

Research on Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) presents distinctive challenges and opportunities that shape the field's trajectory. Understanding these factors is essential for developing effective research strategies.

Key Challenges:

  • Technical Limitations:

    • Extreme oxygen sensitivity requiring specialized anaerobic techniques

    • Membrane association complicating expression and purification

    • Complex assembly requirements with multiple subunits

    • Limited availability of genetic tools for native archaeal hosts

  • Knowledge Gaps:

    • Incomplete understanding of post-translational modifications

    • Limited structural information about the complete enzyme complex

    • Unclear details of the catalytic mechanism

    • Unknown regulatory mechanisms controlling expression and activity

  • Methodological Constraints:

    • Difficulty in developing high-throughput assays

    • Challenges in reproducing native cellular environment

    • Limited options for real-time activity monitoring

    • Complexity in distinguishing individual subunit contributions

Promising Opportunities:

  • Technological Advancements:

    • New structural biology methods for membrane protein complexes

    • Improved genetic systems for methanogenic archaea

    • Advanced spectroscopic techniques for mechanism elucidation

    • Computational approaches for structure-function prediction

  • Interdisciplinary Applications:

    • Connections to climate science through methane cycling

    • Biotechnological applications in biofuel production

    • Evolutionary insights into ancient metabolic systems

    • Potential for novel biocatalyst development

  • Methodological Innovations:

    • Development of standardized protocols for cross-laboratory comparison

    • Creation of archaeal expression systems with controlled modification capacity

    • Design of specific inhibitors as research tools

    • Integration of systems biology approaches for pathway analysis

By addressing these challenges through innovative approaches, researchers can advance our understanding of mtrB and its role in methanogenesis, contributing to both fundamental knowledge and applied solutions to global challenges.

How can researchers optimize their experimental approach when beginning work with mtrB?

Researchers initiating studies with Methanococcus aeolicus mtrB should implement a strategic approach that builds on established knowledge while addressing known challenges. The following framework provides a roadmap for effective experimental design:

1. Initial Preparation and Background Research:

  • Comprehensive literature review of methanogenic methyltransferases

  • Identification of key methodological papers on related proteins

  • Consultation with established researchers in the field

  • Assessment of available infrastructure for anaerobic work

2. Expression System Selection:
Based on the observation that "Methanogenic and ANME MCRs are successfully expressed and assembled in M. maripaludis" , consider:

  • Archaeal expression hosts for authentic post-translational modifications

  • Co-expression with other subunits when necessary

  • Carefully designed affinity tags that minimize functional interference

  • Inducible expression systems for toxic protein management

3. Experimental Design Implementation:
Following established principles , prioritize:

  • Clear hypothesis formulation with testable predictions

  • Systematic variable management (independent, dependent, controlled)

  • Appropriate controls for each experiment

  • Statistical power analysis before beginning experiments

4. Technical Infrastructure Requirements:

Infrastructure ElementSpecificationAlternative ApproachesQuality Control
Anaerobic chamberCatalyst-maintained atmosphere (<1 ppm O₂)Sealed anaerobic vesselsOxygen indicators, activity preservation
Temperature controlRange covering 20-65°CWater bath incubationTemperature logging
Purification systemFPLC with anaerobic capabilityManual chromatography in chamberPurity assessment after each step
Activity assay setupSpectrophotometric or radioisotopicEndpoint product analysisStandard curves, reaction linearity

5. Collaboration and Standardization:
Drawing from molecular tumor board research principles, "we recommend discussing a consensus for assessing relevant parameters that should be standardized between groups" . This includes:

  • Adopting common buffer systems and assay conditions

  • Sharing reference materials and standards

  • Participating in multi-laboratory validation studies

  • Contributing to repository development for mutants and protocols

6. Assessment and Reporting Framework:
Ensure comprehensive assessment using complementary approaches :

  • Multiple technical measures of protein characteristics

  • Combination of targeted and open-ended functional assays

  • Thorough documentation of all methods and conditions

  • Complete reporting of both positive and negative results

This systematic approach maximizes the likelihood of successful outcomes when beginning work with mtrB, while building upon established knowledge and contributing to standardized practices in the field.

What key resources should researchers consult when studying mtrB?

Researchers investigating Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) should utilize a diverse set of resources to inform their experimental approach and contextual understanding. These essential resources include:

1. Primary Databases:

  • UniProt entry A6UWH6: Comprehensive protein information for mtrB

  • Protein Data Bank: Structural information on related methyltransferases

  • BRENDA: Enzyme functional data for EC 2.1.1.86

  • KEGG: Methanogenesis pathway mapping and related enzymes

  • IMG/JGI: Genomic context of mtrB in Methanococcus aeolicus

2. Specialized Resources:

  • Methane-related enzyme repositories

  • Archaeal genetic systems databases

  • Anaerobic microbiology method collections

  • Methanogenesis mechanism resources

  • Enzyme modification databases

3. Methodological Literature:

  • Anaerobic protein expression protocols

  • Methyl-transfer assay methodologies

  • Membrane protein purification guides

  • Experimental design frameworks for enzymology

  • Assessment strategies for protein function

4. Equipment and Infrastructure Specifications:

  • Anaerobic chamber systems

  • Specialized fermentation equipment for methanogenic organisms

  • Gas chromatography setups for methane detection

  • Mass spectrometry configurations for PTM analysis

  • Spectrophotometric systems for enzyme assays

5. Collaborative Networks:

  • Methanogenesis research consortia

  • Archaeal genetics communities

  • Structural biology platforms for membrane proteins

  • Biogeochemical cycling research networks

  • Climate-related methane research initiatives

By leveraging these diverse resources, researchers can develop comprehensive approaches to studying mtrB that build upon existing knowledge while addressing current gaps in understanding. The integration of database information, methodological expertise, and collaborative opportunities provides a robust foundation for advancing research in this challenging but important area of methanogenesis biochemistry.

How can researchers contribute to standardizing mtrB research methodologies?

Standardization of research methodologies is critical for advancing mtrB research and enabling meaningful cross-laboratory comparisons. Drawing parallels from molecular tumor board research, which emphasized "the need for standardized evaluation criteria to enable robust comparisons across studies" , researchers can contribute to methodology standardization through:

1. Protocol Development and Sharing:

  • Publication of detailed, reproducible methods

  • Deposition of protocols in repositories (e.g., protocols.io)

  • Video demonstrations of specialized techniques

  • Distribution of reference materials and standards

2. Consensus-Building Activities:

  • Organization of focused methodology workshops

  • Collaborative multi-laboratory validation studies

  • Development of minimum information reporting standards

  • Regular review and update of recommended practices

3. Standardization Framework Implementation:

Methodological AspectStandardization ApproachValidation MethodImplementation Tools
Protein expressionConsensus host and conditionsExpression yield and activityShared constructs and strains
Activity assaysStandard buffer and substrate concentrationsInter-laboratory testingDistributed reference proteins
Data analysisUnified analytical approachesStatistical validationOpen-source software packages
ReportingComprehensive methods documentationPublication review processStructured reporting templates

4. Quality Control Implementation:

  • Development of reference standard proteins

  • Round-robin testing among laboratories

  • Proficiency testing programs

  • Certification of standardized methodologies

5. Training and Knowledge Transfer:

  • Workshop organization for standardized techniques

  • Development of training materials and courses

  • Mentorship programs for new researchers

  • Open access educational resources

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.