Recombinant Methanococcus aeolicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
uppP; Maeo_1371; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Target Names
uppP
Target Protein Sequence
MDIIQVIVLSIIEGITEFLPISSTGHLIIVSNLMNLAQNAVQTNFEITIQLASIFAVCYE YREKFYNNLELWKKIIISFIPVGIMGLLFHKIVYQLFTVQIVATAFIVGGIIFLIVEKYY KEKEHNIKDLKDISYKQSLLIGIAQAFSLIPGTSRSGATIVGGMLCNLNRKTATEFSFLG ALPVMLAASLFDIVKHHSELGSGDISNLVVGFIVSFFMALITIRLFLKYIEKYNFVPFGI YRILFGVILLMFFVR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in Methanococcus aeolicus?

Undecaprenyl-diphosphatase (EC 3.6.1.27) is an enzyme that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to form undecaprenyl phosphate. In Methanococcus aeolicus, this enzyme plays a critical role in cell envelope biogenesis, specifically in the recycling of lipid carriers involved in the synthesis of cell wall components. The enzyme is encoded by the uppP gene (locus tag Maeo_1371) in the Nankai-3 strain of M. aeolicus .

Methodologically, researchers investigating the function of uppP should consider:

  • Comparative genomic analyses with bacterial homologs to identify conserved catalytic residues

  • Enzyme activity assays measuring phosphate release to quantify dephosphorylation activity

  • Gene knockout or knockdown studies to assess essentiality in archaeal cell envelope formation

  • Metabolic labeling experiments to track undecaprenyl carrier recycling in vivo

What are the optimal storage and handling conditions for recombinant uppP?

For maximum stability and activity retention of recombinant M. aeolicus uppP, the following conditions are recommended:

Storage DurationTemperatureBuffer CompositionAdditional Notes
Short-term (≤1 week)4°CTris-based bufferStore as working aliquots
Medium-term-20°CTris-based buffer with 50% glycerolAvoid repeated freeze-thaw cycles
Long-term-80°CTris-based buffer with 50% glycerolPrepare multiple small aliquots

For experimental handling:

  • Thaw protein samples rapidly in a water bath at room temperature

  • Keep on ice during experimental setup to minimize degradation

  • Consider adding protease inhibitors when working with crude extracts

  • For membrane proteins like uppP, maintain appropriate detergent concentrations above the critical micelle concentration throughout handling

What expression systems are most effective for producing recombinant Methanococcus aeolicus uppP?

Several expression systems can be employed for recombinant uppP production, each with specific advantages:

  • E. coli-based expression systems:

    • BL21(DE3) strains with T7 promoter-based vectors for high-level expression

    • C41/C43(DE3) strains specifically designed for membrane protein expression

    • Codon-optimized gene sequences to account for archaeal codon bias

    • Consider using low copy number vectors as archaeal genes can be toxic in E. coli

  • Archaeal host systems:

    • Methanococcus maripaludis as a genetically tractable methanogen host

    • Phosphate-regulated promoters (like Ppst) for controlled expression

    • Expression in late log phase to minimize potential toxicity effects

  • Cell-free expression systems:

    • Particularly useful for membrane proteins like uppP

    • Allows direct incorporation into nanodiscs or liposomes

    • Circumvents potential toxicity issues in living cells

When selecting an expression system, researchers should perform small-scale expression trials with different constructs (varying tags, fusion partners, etc.) before proceeding to large-scale production.

What purification strategies are recommended for obtaining high-quality recombinant uppP?

A multi-step purification approach is typically required to obtain homogeneous and active uppP:

  • Initial extraction:

    • For membrane proteins like uppP, screen multiple detergents (DDM, LDAO, OG) for optimal solubilization

    • Consider using fluorinated detergents which can better maintain membrane protein structure

    • Use gentle extraction conditions to maintain protein folding and activity

  • Affinity purification:

    • Utilize N- or C-terminal affinity tags (His, FLAG, etc.) for initial capture

    • Consider tag position carefully as it may affect protein folding or function

    • Include detergent at concentrations above CMC in all buffers

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

    • Ion exchange chromatography for removing contaminating proteins

    • Negative purification steps to remove specific contaminants

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry for accurate molecular weight determination and peptide mapping

    • Activity assays to confirm functional integrity

For proteomics-based verification of purified uppP, techniques similar to those used for other Methanococcus proteins can be employed, including MS/MS analysis with 20 ppm and 0.6 Da precursor and fragment mass tolerances, respectively .

What enzymatic assays can be used to measure undecaprenyl-diphosphatase activity?

Several complementary approaches can quantify uppP enzymatic activity:

  • Colorimetric phosphate release assays:

    • Malachite green assay with sensitivity in the nanomolar range

    • Enzyme-coupled continuous assays linking phosphate release to NADH oxidation

    • Advantage: simple implementation and real-time monitoring

  • Chromatographic methods:

    • HPLC separation of substrate and product using reverse-phase columns

    • TLC analysis with appropriate staining for lipid visualization

    • Advantage: direct visualization of substrate consumption and product formation

  • Radiolabeled substrate approaches:

    • Using 32P-labeled undecaprenyl pyrophosphate to track dephosphorylation

    • Scintillation counting or phosphorimaging for quantification

    • Advantage: higher sensitivity for kinetic measurements

  • Fluorescence-based assays:

    • FRET-based sensors for real-time activity monitoring

    • Fluorescent substrate analogs for continuous measurement

    • Advantage: amenable to high-throughput screening

For establishing reliable enzyme kinetics, researchers should:

  • Carefully control detergent:substrate ratios to avoid artifact measurements

  • Include appropriate controls for non-enzymatic hydrolysis

  • Ensure linear reaction conditions for initial velocity measurements

  • Consider substrate presentation (micellar vs. vesicular) effects on activity

How can site-directed mutagenesis be used to identify critical residues in uppP function?

A systematic mutagenesis approach can elucidate structure-function relationships in M. aeolicus uppP:

  • Targeting conserved residues:

    • Compare uppP sequences across archaea and bacteria to identify highly conserved amino acids

    • Focus on aspartate, glutamate, histidine, and lysine residues as potential catalytic residues

    • Create alanine substitutions first, followed by conservative substitutions to refine functional roles

  • Membrane interface residues:

    • Target residues at predicted membrane-aqueous interfaces

    • Modify hydrophobicity to alter membrane association

    • Investigate amphipathic helices that may be important for substrate access

  • Substrate binding pocket:

    • Identify potential substrate-binding residues through homology modeling

    • Create mutations that alter pocket size or charge characteristics

    • Test substrate specificity changes with modified enzymes

  • Functional validation:

    • Combine mutagenesis with kinetic analysis to determine effects on Km and kcat

    • Use thermal shift assays to assess structural impacts of mutations

    • Consider complementation studies in bacterial uppP mutants to test functional conservation

This approach has been successfully applied to other archaeal enzymes, including those from Methanococcus species, revealing key functional residues and catalytic mechanisms .

How does archaeal uppP compare to bacterial homologs in terms of structure and function?

Comparative analysis reveals both similarities and important differences between archaeal and bacterial undecaprenyl-diphosphatases:

FeatureArchaeal uppPBacterial uppPMethodological Implications
Membrane topologyPredicted multiple transmembrane domains4-8 transmembrane domainsDifferent detergent requirements for solubilization
Substrate specificityMay accommodate archaeal-specific lipid carriersOptimized for bacterial undecaprenyl pyrophosphateNeed for custom substrates in enzymatic assays
Catalytic mechanismConserved acidic residues in predicted active siteMetal-dependent phosphatase activityDifferent buffer and metal ion requirements
Inhibitor sensitivityLargely unknownVarious classes of inhibitors characterizedOpportunity for selective inhibitor development

For rigorous comparative studies, researchers should:

  • Perform detailed sequence and structural alignments

  • Express and characterize both archaeal and bacterial enzymes under identical conditions

  • Test cross-functionality through heterologous complementation studies

  • Investigate evolutionary trajectories through phylogenetic analyses

What role does uppP play in the unique cell envelope biogenesis of archaea?

The function of uppP in archaeal cell envelope biogenesis likely differs from its bacterial counterpart due to fundamental differences in cell envelope architecture:

  • Lipid carrier recycling:

    • Archaeal membranes contain ether-linked isoprenoid lipids rather than ester-linked fatty acids

    • uppP may process archaeal-specific lipid carriers with different structures

    • Experimental approach: Lipid analysis combined with metabolic labeling

  • Cell wall precursor transport:

    • Many archaea lack peptidoglycan but possess other cell wall polymers

    • uppP may participate in archaeal-specific biosynthetic pathways

    • Experimental approach: Genetic knockdown combined with cell wall composition analysis

  • Integration with archaeal-specific processes:

    • Potential involvement in S-layer glycoprotein biosynthesis

    • Possible role in archaeal-specific membrane remodeling

    • Experimental approach: Protein interaction studies and co-purification experiments

Understanding these unique aspects requires integrated approaches combining genetics, biochemistry, and structural biology tailored to archaeal systems.

How can uppP be used as a model protein for studying membrane protein expression and folding in archaea?

Recombinant uppP provides an excellent model system for developing archaeal membrane protein methodologies:

  • Expression optimization:

    • Testing various promoter systems, including phosphate-regulated promoters as used in M. maripaludis

    • Comparing different host systems for archaeal membrane protein expression

    • Developing specialized vectors for archaeal membrane proteins

  • Membrane integration studies:

    • Investigating the archaeal translocon machinery requirements

    • Comparing co-translational vs. post-translational insertion mechanisms

    • Examining lipid-protein interactions in archaeal membranes

  • Folding assessment techniques:

    • Adapting folding reporter assays for archaeal membrane proteins

    • Developing archaeal-specific membrane mimetics for in vitro studies

    • Creating complementation assays to verify functional folding

  • Structural biology applications:

    • Testing novel crystallization approaches for archaeal membrane proteins

    • Optimizing sample preparation for cryo-EM analysis

    • Developing NMR methodologies suitable for archaeal membrane proteins

These approaches not only advance uppP research but also establish broadly applicable methods for studying other archaeal membrane proteins.

What are the most effective troubleshooting strategies for recombinant uppP expression and activity issues?

When encountering challenges with recombinant uppP, systematic troubleshooting approaches include:

  • Low expression yields:

    • Screen lower induction temperatures (18-20°C) and extended induction times

    • Test different detergents for improved extraction efficiency

    • Consider fusion partners known to enhance membrane protein expression

    • Evaluate codon optimization for the expression host

  • Poor enzyme activity:

    • Verify proper folding using limited proteolysis or thermal shift assays

    • Screen buffer conditions systematically (pH, ionic strength, cofactors)

    • Test reconstitution into liposomes or nanodiscs to provide native-like environment

    • Ensure detergent concentration is appropriate (above CMC but not excessively high)

  • Protein instability:

    • Add stabilizing agents such as glycerol (50% for storage) or specific lipids

    • Test different purification strategies to minimize exposure to destabilizing conditions

    • Consider protein engineering approaches to enhance stability

    • Identify and eliminate proteolytic susceptibility sites

  • Aggregation issues:

    • Optimize detergent:protein ratios during extraction and purification

    • Include mild solubilizing agents like arginine or proline in buffers

    • Control temperature during all handling steps

    • Consider on-column refolding approaches for inclusion body recovery

These strategies have been successfully applied to other challenging membrane proteins from archaeal sources and can be adapted for uppP research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.