Recombinant Methanococcus aeolicus UPF0290 protein Maeo_1211 (Maeo_1211)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression Systems

  • Host Organisms: E. coli, yeast, or mammalian cells (host-dependent optimization) .

  • Vector Systems: Includes pET21b (for His-tagged proteins) and pACYCΔtet/pESC-LEU (for constitutive expression in E. coli) .

Functional Studies

  • Antibody Development: Used as an antigen in ELISA assays to generate specific antibodies .

  • Protein Interaction Mapping: Potential utility in studying membrane-associated pathways, though functional data remain limited .

Genomic Context

  • Genome Annotation: Encoded in the M. aeolicus Nankai-3 genome (NC_009635.1: 1,279,339–1,279,875) .

  • Synteny: Absent in related strains like M. aeolicus PL15/H, highlighting strain-specific genomic diversity .

Research Findings and Challenges

Functional Uncertainty

  • UPF0290 Family: Belongs to a conserved but functionally uncharacterized protein family (HAMAP-Rule MF_01117) .

  • Membrane Localization: Predicted multi-pass structure suggests roles in transport or signaling, though experimental validation is lacking .

Comparative Genomics

  • Strain-Specific Presence: Unlike M. aeolicus PL15/H (which lacks the MaeIII restriction system), strain Nankai-3 retains the Maeo_1211 locus .

  • Evolutionary Diversity: Homologs are found in archaea (e.g., Methanothermococcus spp.) and bacteria (e.g., Hippea alviniae), though functional roles remain elusive .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
carS; Maeo_1211; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Target Names
carS
Target Protein Sequence
MSIIYLVINSFIFILPAYVANATPCIFGGGAPIDGGKCFFDGRRIIGNGVSWKGTFFGLF CGTITAILEGIIFNLNIFGTVAFNFNVFEWGIVGLLLSAGALFGDAIGSFIKRRLGLAQG RPAPILDQLGFIVFALLFVYPFAPVSYEMGIFLLVITPMIHLSANIIAYKLGIKDVWW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction constitutes the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Methanococcus aeolicus UPF0290 protein Maeo_1211?

Recombinant Methanococcus aeolicus UPF0290 protein Maeo_1211 is a protein from the archaeal organism Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) with UniProt accession number A6UWB6. This protein belongs to the UPF0290 protein family, which consists of uncharacterized proteins with conserved functions across various archaeal species. The recombinant form is expressed in expression systems (often E. coli) to produce the protein for research purposes. The full-length protein consists of 178 amino acids with a specific sequence that suggests membrane-associated functions based on its hydrophobic properties .

How does Maeo_1211 compare to other UPF0290 family proteins from different archaeal species?

UPF0290 family proteins are found across various archaeal species including Methanocorpusculum labreanum (Mlab_0318) and others. Comparative sequence analysis shows conserved domains typical of this protein family, though with species-specific variations. The Methanocorpusculum labreanum UPF0290 protein Mlab_0318 consists of 176 amino acids compared to the 178 amino acids in Maeo_1211 . While both proteins belong to the same family, they likely have evolved specific adaptations to their respective organisms' environmental niches. Sequence alignment studies typically reveal conserved motifs across the UPF0290 family that may be critical for the protein's function, while variable regions might reflect species-specific adaptations.

What are the optimal storage and handling conditions for Recombinant Maeo_1211?

For optimal preservation of structure and function, Recombinant Maeo_1211 should be stored at -20°C for regular use, or at -80°C for extended storage. The protein is typically supplied in a Tris-based buffer with 50% glycerol to maintain stability during freeze-thaw cycles. For experimental work, it's recommended to prepare small working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles which can lead to protein degradation and loss of activity. When handling the protein, maintain sterile conditions and use appropriate buffers that maintain the protein's native conformation .

How can researchers effectively validate the purity and integrity of Maeo_1211 preparations?

Validation of Maeo_1211 purity and integrity should involve multiple analytical techniques:

  • SDS-PAGE analysis to verify molecular weight and initial purity assessment

  • Western blotting using antibodies specific to the protein or its tag (if present)

  • Mass spectrometry to confirm the exact molecular weight and sequence coverage

  • Size exclusion chromatography to assess aggregation states

  • Circular dichroism spectroscopy to evaluate secondary structure integrity

For tagged versions of the protein (often His-tagged for purification purposes), additional validation can include tag-specific assays. Functional assays, while challenging for uncharacterized proteins, might include binding studies with predicted interaction partners based on bioinformatic analysis of similar UPF0290 family proteins .

What experimental approaches are recommended for studying membrane-associated proteins like Maeo_1211?

Due to the hydrophobic nature and predicted transmembrane domains in Maeo_1211, specialized techniques for membrane protein research are recommended:

TechniqueApplicationAdvantagesLimitations
Detergent solubilizationExtraction from membranesMaintains protein solubilityMay disrupt native structure
Liposome reconstitutionFunctional studiesMimics native environmentTechnical complexity
NanodiscsStructural studiesStable membrane mimeticSize constraints
Cryo-electron microscopyStructural determinationHigh resolution without crystalsSample preparation challenges
Solid-state NMRStructural analysisIn-membrane analysisComplex data interpretation

When designing experiments, consider that membrane proteins often require specific detergents or lipid environments to maintain their native conformation and activity. For functional studies, reconstitution into liposomes of appropriate lipid composition may be necessary to observe physiologically relevant activity .

How can researchers investigate the potential functional role of Maeo_1211 in Methanococcus aeolicus?

Investigating the functional role of an uncharacterized protein like Maeo_1211 requires multiple approaches:

  • Genomic context analysis: Examine neighboring genes in the M. aeolicus genome to identify potential functional relationships or operonic structures.

  • Protein-protein interaction studies: Use pull-down assays, bacterial/yeast two-hybrid systems, or crosslinking approaches to identify interaction partners.

  • Gene knockout/knockdown studies: Generate deletion mutants in M. aeolicus or related archaeal species where genetic tools are available to observe phenotypic changes.

  • Heterologous expression: Express Maeo_1211 in model organisms to observe gain-of-function phenotypes.

  • Structural biology approaches: Determine the three-dimensional structure using X-ray crystallography, NMR, or cryo-EM to gain insights into potential functional sites.

Researchers should also consider comparative genomics approaches, analyzing the conservation and co-occurrence patterns of UPF0290 family proteins across archaeal species to infer potential functions based on evolutionary constraints .

What bioinformatic approaches can help predict the function of UPF0290 family proteins like Maeo_1211?

Advanced bioinformatic approaches provide valuable insights into potential functions of uncharacterized proteins:

  • Protein fold recognition and threading: These methods compare the sequence with proteins of known structure to predict tertiary structure.

  • Molecular dynamics simulations: Simulate protein behavior in membrane environments to identify potential functional conformations.

  • Evolutionary coupling analysis: Identify co-evolving residues that might be functionally important or involved in protein-protein interactions.

  • Gene neighborhood conservation: Analyze the conservation of genomic context across multiple species.

  • Phylogenetic profiling: Identify proteins with similar phylogenetic distributions, suggesting functional relationships.

Machine learning approaches incorporating multiple data types (sequence, structure, genomic context, expression patterns) can also provide function predictions with higher confidence than single methods. For membrane proteins like Maeo_1211, specialized prediction tools for transmembrane topology and lipid interaction sites should be employed .

How might Maeo_1211 be involved in adaptations specific to Methanococcus aeolicus's extreme environment?

Methanococcus aeolicus is a mesophilic methanogen isolated from deep-sea sediments, suggesting adaptations to moderate temperature but potentially high pressure conditions. The membrane-associated nature of Maeo_1211 suggests potential roles in:

  • Membrane integrity maintenance: The protein might help maintain membrane fluidity and integrity under pressure.

  • Specialized transport functions: It could facilitate the transport of specific substrates required for methanogenesis.

  • Sensing environmental conditions: The protein might participate in signaling cascades responding to environmental changes.

  • Methane metabolism: Given the methanogenic nature of M. aeolicus, the protein could play a role in specialized membrane-associated methane production pathways.

Comparative studies with homologous proteins from other archaea adapted to different environmental conditions (e.g., thermophiles, halophiles) could reveal environment-specific adaptations in the protein sequence and structure. Researchers should consider designing experiments that test protein function under conditions mimicking the native environment of M. aeolicus .

What are common challenges in expressing and purifying Maeo_1211, and how can they be addressed?

Membrane proteins like Maeo_1211 present several challenges in recombinant expression and purification:

ChallengeSolution ApproachMethodological Considerations
Low expression levelsOptimize codon usage; use specialized expression systemsConsider archaeal expression hosts or cell-free systems for challenging proteins
Protein aggregationScreen multiple detergents; use fusion partnersSystematic detergent screening with stability assays
Improper foldingLower expression temperature; use chaperone co-expressionMonitor folding with circular dichroism or fluorescence-based assays
Function loss during purificationReconstitute in lipid nanodiscs or liposomesDevelop functional assays to track activity during purification
Difficulty in tag removalDesign cleavage sites accessible in detergent micellesUse mass spectrometry to confirm complete tag removal

When expressing archaeal proteins in bacterial systems, consider temperature optimization, as lower temperatures often improve folding of heterologous proteins. For membrane proteins specifically, specialized E. coli strains with modified membrane composition or the addition of specific lipids to growth media may improve expression yields and proper folding .

How can researchers effectively study protein-protein interactions involving Maeo_1211?

Studying protein-protein interactions for membrane proteins requires specialized approaches:

  • Membrane yeast two-hybrid systems: Modified to accommodate membrane proteins.

  • Bimolecular Fluorescence Complementation (BiFC): Allows visualization of interactions in cellular contexts.

  • Proximity labeling methods: BioID or APEX2 fusions to identify neighboring proteins in native environments.

  • Co-immunoprecipitation with crosslinking: Stabilizes transient interactions prior to extraction.

  • Surface Plasmon Resonance (SPR): Quantitative binding analysis with immobilized protein.

  • Microscale Thermophoresis (MST): Measures interactions in solution with minimal protein consumption.

When designing interaction studies, consider the native membrane environment of Maeo_1211 and how detergents or artificial membranes might affect interaction dynamics. For comprehensive interaction mapping, combining multiple complementary techniques provides higher confidence results and can reveal both stable and transient interactions .

What approaches can be used to investigate dynamic changes in Maeo_1211 binding properties under different conditions?

Similar to studies performed with other proteins like MAO-A, researchers can employ various techniques to study dynamic binding properties:

  • Radiolabeled ligand binding assays: Measure binding under different physiological conditions.

  • Fluorescence-based binding assays: Monitor real-time binding using fluorescently labeled ligands or intrinsic fluorescence.

  • Isothermal Titration Calorimetry (ITC): Measure thermodynamic parameters of binding under varying conditions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Detect conformational changes upon ligand binding or environmental shifts.

  • Molecular dynamics simulations: Model binding pocket dynamics under different conditions.

For studying environmental adaptations, researchers should systematically vary conditions (pH, salt concentration, pressure, temperature) relevant to the native environment of M. aeolicus. Comparative studies with homologous proteins from other archaeal species can highlight environment-specific binding characteristics .

How might research on Maeo_1211 contribute to understanding archaeal membrane biology?

Research on Maeo_1211 has potential to advance several aspects of archaeal membrane biology:

  • Membrane architecture: Understanding how specialized membrane proteins contribute to the unique lipid monolayer structure of archaeal membranes.

  • Environmental adaptation mechanisms: Insights into how membrane proteins facilitate survival in extreme or specialized environments.

  • Evolutionary biology: Comparison with bacterial and eukaryotic membrane proteins to understand divergent and convergent evolution.

  • Archaeal physiology: Potential roles in methanogenesis or other archaeal-specific metabolic pathways.

Studies on UPF0290 family proteins across different archaeal species can reveal conserved mechanisms in archaeal membrane biology and identify specialized adaptations in different ecological niches. This research may also contribute to synthetic biology applications aiming to utilize archaeal membrane components for biotechnological purposes .

What technical advances in structural biology would benefit research on challenging membrane proteins like Maeo_1211?

Several cutting-edge structural biology approaches hold promise for advancing research on challenging membrane proteins:

  • Cryo-electron microscopy advancements: Improvements in detector technology and image processing algorithms continue to push resolution limits for membrane proteins without crystallization.

  • Integrative structural biology approaches: Combining multiple experimental techniques (X-ray crystallography, NMR, SAXS, crosslinking mass spectrometry) to generate comprehensive structural models.

  • AI-based structure prediction: Recent advances in protein structure prediction (e.g., AlphaFold2, RoseTTAFold) show promising results for membrane proteins.

  • Mass photometry: Emerging technique for analyzing membrane protein complexes in near-native environments.

  • Serial crystallography at X-ray free-electron lasers: Allows structure determination from microcrystals of membrane proteins.

Researchers should consider how these advanced techniques might be applied to Maeo_1211 and similar challenging membrane proteins, potentially revealing structural details that inform functional hypotheses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.