Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Methanogenesis

mtrB functions as a subunit of the tetrahydromethanopterin S-methyltransferase complex, which catalyzes the methyl transfer from methyl-tetrahydromethanopterin (CH3_3-H4_4MPT) to coenzyme M (HS-CoM) during the Wolfe cycle . This step is coupled with sodium ion (Na+^+) translocation across the membrane, contributing to the proton gradient essential for ATP synthesis . Key mechanistic details include:

  • Substrates: Methyl-H4_4MPT and HS-CoM.

  • Reaction: CH3_3-H4_4MPT + HS-CoM → H4_4MPT + CH3_3-S-CoM.

  • Cofactors: Requires nickel-containing coenzyme F430_{430} and modified amino acids (e.g., methylated arginine, histidine) .

Enzyme Assembly Studies

Heterologous expression of mtrB in M. maripaludis has clarified its role in methyl coenzyme M reductase (MCR) assembly. Chimeric operons combining mtrB with subunits from other methanogens (e.g., Methanothermococcus okinawensis) confirmed that recombinant mtrB integrates into functional MCR complexes without cross-assembling with native subunits .

Metabolic Engineering

Recombinant mtrB has been utilized in metabolic engineering to optimize carbon fixation pathways. For example:

  • S-3-Hydroxybutyrate (S-3HB) Production: Engineered M. maripaludis strains expressing mtrB alongside phaA (thiolase) and tesB (thioesterase) achieved S-3HB titers of 171 mg/L, demonstrating redirected carbon flux toward bioplastics .

  • NAD(H) Pool Modulation: Co-expression with NAD+^+-enhancing enzymes (e.g., formate dehydrogenase) improved pathway efficiency by 25–43% .

Stability and Handling Recommendations

  • Storage: Avoid repeated freeze-thaw cycles; aliquot for long-term use .

  • Activity Preservation: Glycerol (up to 50%) and trehalose stabilize the enzyme during reconstitution .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery information, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrB; MmarC5_0013; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Target Names
mtrB
Target Protein Sequence
MDIVKVCPEIQIAMDIDSGLIAEMRKDILVVDLHPVEDEINRLAQYAKALENSLDPRNSP MKAYAGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process represents an energy-conserving, sodium-ion translocating step.
Database Links
Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural role of mtrB in the Mtr complex?

The mtrB helix shows distinctive structural features, including an outward-directed hairpin-shaped linker at the membrane boundary and an inclination of approximately 20° toward the threefold axis within the membrane . These features likely contribute to the unique functional properties of the Mtr complex in coordinating methyl transfer with ion transport.

How does mtrB contribute to the energy conservation mechanism in M. maripaludis?

The Mtr complex, of which mtrB is an integral component, catalyzes the transfer of a methyl group from methyl-tetrahydromethanopterin (methyl-H4MPT) to coenzyme M. This reaction is coupled with Na+ transport across the membrane, which is essential for energy conservation in methanogenic archaea . While the exact mechanism remains to be fully elucidated in M. maripaludis specifically, studies of related methanogens suggest that mtrB participates in maintaining the structural integrity required for this coupled reaction.

The methyl transfer process involves a two-step reaction via a cobamide-containing intermediate, and structural changes in the complex facilitate ion movement across the membrane . As part of this multisubunit complex, mtrB likely contributes to creating the conformational states necessary for efficient coupling of chemical reactions with ion transport.

What expression systems are most suitable for recombinant mtrB production?

Different expression systems offer various advantages for recombinant mtrB production:

Expression SystemYieldTurnaround TimePost-translational ModificationsBest Application
E. coliHighShortLimitedStructural studies
YeastHighShortModerateStructural and basic functional studies
Insect cellsModerateModerateGoodFunctional studies requiring proper folding
Mammalian cellsLowLongExcellentStudies requiring native-like activity

What promoter systems are most effective for expressing recombinant proteins in M. maripaludis?

Promoter selection significantly impacts recombinant protein expression levels in M. maripaludis. Based on studies of other recombinant proteins in this organism, two promoter systems have been characterized:

PromoterTypeExpression LevelCharacteristics
P hmvAConstitutive histone2.4% of total proteinContinuous expression throughout growth
P pstPhosphate-dependent5.8% of total proteinInducible upon phosphate limitation

The phosphate-dependent promoter (P pst) yields significantly higher protein levels than the constitutive histone promoter (P hmvA), making it particularly valuable for recombinant protein production . This promoter initiates expression upon phosphate limitation, partially separating expression from growth, which can be advantageous for producing proteins that might be toxic or growth-inhibiting when expressed at high levels during active cell division.

How can researchers generate M. maripaludis mutants to study mtrB function?

Generation of M. maripaludis mutants with in-frame deletions of targeted genes follows an established methodology that can be applied to mtrB:

  • Design and construct a deletion plasmid containing sequences flanking the target gene while omitting the gene itself

  • Transform M. maripaludis with the deletion plasmid

  • Select transformants using appropriate markers (such as puromycin resistance)

  • Screen colonies by PCR using primers that amplify across the target gene to identify deletion mutants

  • Restreak positive mutants and screen single colonies again by PCR to ensure purity

This approach allows for markerless in-frame deletions, making it possible to study the effects of mtrB deletion on methanogenesis without polar effects on downstream genes. This technique could be particularly valuable for understanding the necessity of mtrB for Mtr complex assembly and function.

What purification strategies are most effective for isolating recombinant mtrB?

For effective purification of recombinant mtrB from expression hosts, a multistep strategy is recommended:

  • Affinity tagging: Addition of affinity tags (such as Flag-Strep2) to the N-terminus of mtrB facilitates specific purification while minimally affecting protein function

  • Membrane extraction: As mtrB contains a membrane-spanning helix, careful selection of detergents for extraction from the membrane is critical to preserve structure and function

  • Affinity chromatography: Using the engineered affinity tag for initial purification

  • Size exclusion chromatography: To separate properly folded protein from aggregates

  • Quality assessment: Using techniques such as SDS-PAGE, Western blotting, and mass spectrometry to verify protein purity and integrity

For optimal results with membrane proteins like mtrB, gentle cell disruption methods may be preferable. For instance, treatment with pseudomurein endopeptidase has been shown to prevent loss of interacting proteins during purification of similar complexes .

How does temperature affect the expression of recombinant proteins in M. maripaludis?

Temperature has been identified as a critical factor for recombinant protein production in M. maripaludis. While the organism's optimum growth temperature is 37°C, expression at lower temperatures can significantly improve the production of certain recombinant proteins .

This temperature effect is particularly pronounced for proteins naturally found in cold environments. For example, when expressing proteins from deep-sea archaea that typically inhabit environments with temperatures near 2°C, expression at temperatures closer to M. maripaludis' lower growth limit resulted in better protein production .

This observation suggests that matching the expression temperature to the native temperature of the source organism can be crucial for successful recombinant protein production. For mtrB from psychrophilic methanogens, lower expression temperatures might similarly improve yield and quality.

How do protein-protein interactions influence mtrB function within the Mtr complex?

The Mtr complex in methanogens consists of eight different subunits (MtrA-H), with complex interactions between them that are critical for function. Studies in related methanogens have shown that subunits can interact both when co-transcribed within the same operon and when expressed separately .

Pull-down experiments with tagged subunits have revealed that certain components can interact with proteins from both recombinant and host species . This suggests a degree of structural conservation that enables cross-species complex formation.

For mtrB specifically, interactions with other subunits (particularly mtrG and mtrF) appear to be important for stable integration into the Mtr complex. In Methanothermobacter, mtrB and mtrF contact each other along much of the stalk structure but become separated inside the membrane, where the intermediate space is occupied by tetraether glycolipids . These interactions likely influence the conformational dynamics of mtrB during catalysis.

What analytical techniques are most informative for studying mtrB structure and dynamics?

Several analytical techniques provide valuable insights into the structure and dynamics of membrane proteins like mtrB:

TechniqueApplicationInformation Obtained
Cryo-electron microscopyStructural analysisHigh-resolution structures of membrane protein complexes
Molecular dynamics simulationsComputational analysisDynamic behavior and conformational changes
Mass spectrometryProtein characterizationPost-translational modifications, protein-protein interactions
Hydrogen-deuterium exchangeConformational analysisIdentification of flexible regions and conformational changes
Site-directed mutagenesisFunctional analysisRole of specific residues in structure and function

For mtrB, a combination of these approaches would provide the most comprehensive understanding. Cryo-EM has proven particularly valuable for related complexes, achieving resolutions of 2.37 Å for the Mtr complex from Methanothermobacter . Integration of experimental data with computational approaches like AlphaFold2 can further enhance structural understanding by providing models of regions not well-resolved in experimental structures .

How can researchers distinguish between structural and functional defects in mtrB mutants?

When analyzing the phenotypes of M. maripaludis strains with mutations in mtrB, distinguishing between structural and functional defects requires a multi-faceted approach:

  • Growth phenotype analysis: Compare growth rates under different conditions (varying carbon sources, Na+ concentrations, etc.) to identify specific metabolic deficiencies

  • Complex assembly assessment: Use pull-down assays with tagged partner proteins to determine if mutant mtrB still incorporates into the Mtr complex

  • In vitro activity assays: Measure methyl transfer activity and Na+ transport to identify specific defects in catalysis or coupling

  • Structural characterization: Use techniques like cryo-EM to directly observe structural changes in the assembled complex

  • Complementation studies: Test whether expression of wild-type mtrB in trans can rescue mutant phenotypes

What are the critical factors affecting reproducibility in mtrB expression studies?

Several factors can significantly impact the reproducibility of mtrB expression and purification:

  • Growth conditions: Strict anaerobic conditions are essential for expressing proteins from methanogens, as exposure to oxygen can damage sensitive proteins and affect growth

  • Expression parameters: Temperature, induction timing, and media composition must be carefully controlled and reported

  • Strain verification: Regular verification of the genetic stability of expression strains is necessary, as spontaneous mutations can occur

  • Protein quality assessment: Consistent methods for assessing protein folding, integrity, and purity are essential

  • Activity measurements: Standardized assays and reaction conditions for functional measurements

For membrane proteins like mtrB, detergent selection during extraction and purification is also critical and should be systematically optimized and consistently applied across experiments.

How does mtrB from M. maripaludis compare structurally to homologs in other methanogens?

While high-resolution structural data specifically for M. maripaludis mtrB is limited, comparisons with related methanogens provide valuable insights:

OrganismmtrB FeaturesNotable Differences
Methanothermobacter speciesLong, partly interrupted helix with N-terminal linear segmentWell-characterized structure with distinctive bends and interactions
M. maripaludisPredicted similar core structureLikely adaptations for mesophilic lifestyle
Other MethanococcalesGenerally conserved architectureVariations in membrane-interacting regions

What is the evolutionary significance of operon structure variation containing mtrB?

Among methanogens, the operon structure containing mtr genes shows interesting variations that have evolutionary implications. While the complete Mtr complex typically consists of eight subunits (MtrA-H), the arrangement and duplication of these genes vary across species .

Some methanogen genomes contain one copy of mtrBDCGA and a second copy of either mtrBDGA or mtrBGA . This pattern of gene duplication suggests a functional specialization, potentially allowing these organisms to optimize methyl transfer under different environmental conditions.

In Methanothermobacter marburgensis, for example, two MCR isoenzymes are differentially expressed depending on H2 concentrations , suggesting that such duplications may play important roles in physiological adaptation. Similar functional specialization might occur with mtrB and other Mtr components, allowing methanogens to fine-tune their energy conservation mechanisms in response to environmental changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.