Recombinant Methanococcus maripaludis UPF0290 protein MmarC5_1708 (MmarC5_1708)

Shipped with Ice Packs
In Stock

Description

Genomic Context and UPF0290 Family

UPF0290 proteins are uncharacterized archaeal proteins. In M. maripaludis:

  • Genome Distribution: The C5 strain encodes MmarC5_1708 in a conserved genomic region, while strain S2 lacks this locus .

  • Functional Inferences:

    • Metabolic Pathways: UPF0290 homologs are not directly linked to methanogenesis, glycolysis, or nucleotide biosynthesis .

    • Phylogenetic Clues: Distant homologs in Methanococcus jannaschii suggest roles in stress response or niche adaptation .

Research Gaps and Future Directions

Potential RoleRationale
Membrane-Associated ProteinHydrophobic N-terminal region could mediate interactions with membrane-bound complexes .
Regulatory ProteinUPF0290 homologs may modulate gene expression under specific growth conditions .
Enzymatic ActivitySequence divergence from C7’s MmarC7_0973 suggests distinct catalytic roles .

Comparative Analysis of UPF0290 Variants

Below is a comparison between MmarC5_1708 (C5 strain) and MmarC7_0973 (C7 strain):

FeatureMmarC5_1708 (A4G0M1)MmarC7_0973 (A6VHW4)
Sequence Length178 aa178 aa
Sequence Identity68% with MmarC7_0973N/A
Genomic ContextSolitary locus in C5Part of C7’s conserved regions
Post-Translational ModificationsUndeterminedUndetermined

Experimental Utility

The recombinant protein is primarily used in:

  • Immunoassays: ELISA development for detecting anti-UPF0290 antibodies .

  • Structural Studies: Crystallization trials to elucidate 3D conformation.

References

  1. CSB-CF413604MNR product page (MmarC7_0973) .

  2. Genome analysis of M. maripaludis .

  3. Creative BioMart (CARS-related pathways, not directly applicable) .

  4. M. maripaludis strain C5 details .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
carS; MmarC5_1708; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Target Names
carS
Target Protein Sequence
MDLLLLLFSAIWYILPAYIANAVPCILGGGRPVDFGKNFFDGYRLIGNGVTYRGTFFGIL FGIITGILQHFIVILYMDPESAFNYGLSGYIILSFLLATGALFGDMLGSFIKRRFKLNQG QSAPLLDQITFIVFALLFAYPFYPLPINTIILLLVISPLIHLSSNIVAYKLHLKKVWW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why study proteins from archaea like Methanococcus maripaludis?

Archaeal proteins like MmarC5_1708 from Methanococcus maripaludis are valuable research subjects for several scientific reasons:

  • Evolutionary insights: Archaea represent one of the three domains of life and studying their proteins provides insights into evolutionary relationships between all cellular organisms.

  • Extremophile adaptations: Many archaea thrive in extreme environments, and their proteins often possess unique structural and functional properties that enable survival under these conditions.

  • Novel biochemical pathways: Archaea frequently employ unique metabolic pathways and enzymes not found in bacteria or eukaryotes, potentially revealing new biochemical mechanisms.

  • Biotechnological applications: The thermostability and unusual properties of archaeal proteins make them candidates for biotechnological applications, including as research tools and in industrial processes.

  • Uncharacterized protein families: Studying UPF0290 proteins like MmarC5_1708 presents opportunities to discover novel protein functions and fill gaps in our understanding of archaeal biology.

What expression systems are optimal for recombinant MmarC5_1708 production?

The choice of expression system for MmarC5_1708 depends on your experimental goals. Based on research with similar archaeal membrane proteins, consider these approaches:

Expression SystemAdvantagesDisadvantagesYieldBest For
E. coli (BL21)High yields, simple protocolPotential misfolding, inclusion bodies5-15 mg/LInitial characterization
E. coli C41/C43Improved membrane protein expressionLower yields than standard strains2-8 mg/LFunctional studies
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scale0.5-2 mg/mLStructure studies
Archaeal hosts (e.g., H. volcanii)Native-like foldingComplex protocols, slower growth1-3 mg/LNative interaction studies

Methodological approach:

  • Begin with codon-optimized constructs for your expression host

  • Test multiple expression tags (N-His, C-His, GST) as MmarC5_1708 may be sensitive to tag position

  • Screen temperature (16-30°C) and inducer concentrations systematically

  • For membrane proteins like MmarC5_1708, inclusion of mild detergents (0.1-0.5% DDM or LDAO) during lysis can improve solubility

  • Consider fusion partners (SUMO, MBP) to enhance solubility if initial expression yields inclusion bodies .

How should MmarC5_1708 be purified for structural studies?

Purification of MmarC5_1708 for structural studies requires a carefully optimized protocol:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with buffers containing appropriate detergents to maintain solubility.

  • Detergent screening table:

DetergentCMC (%)Protein StabilityMicelle SizeRecommended for
DDM0.0087HighLargeInitial extraction
LDAO0.023MediumSmallCrystallization
LMNG0.001Very highMediumCryo-EM studies
OG0.53LowSmallNMR studies
  • Secondary purification: Size exclusion chromatography using a Superdex 200 column in a buffer containing detergent at 2-3× CMC.

  • Buffer optimization: Tris-based buffers (50 mM, pH 7.5-8.0) with 150-300 mM NaCl appear suitable for MmarC5_1708 based on similar archaeal membrane proteins.

  • Quality control: Assess protein homogeneity using dynamic light scattering and SEC-MALS to verify monodispersity before structural studies.

  • Storage considerations: The protein appears to be stable in 50% glycerol at -20°C, though for structural work, flash-freezing concentrated samples in liquid nitrogen may be preferable .

How can computational approaches predict MmarC5_1708 function?

Several computational approaches can provide insights into the potential function of uncharacterized proteins like MmarC5_1708:

  • Sequence-based analysis:

    • Position-specific scoring matrices and hidden Markov models can identify distant homologs

    • Analysis of conserved domains using databases like Pfam, InterPro, and CDD

    • Transmembrane topology prediction using programs like TMHMM, Phobius, and TOPCONS

  • Structural prediction and analysis:

    • Modern AI-based structure prediction tools (AlphaFold2, RoseTTAFold) can generate high-confidence models

    • Structural alignment against known protein folds using DALI or FATCAT

    • Binding site prediction using CASTp, COACH, or FTSite

  • Genomic context analysis:

    • Examination of gene neighborhood conservation across related species

    • Gene fusion events that may indicate functional relationships

    • Co-occurrence patterns across genomes suggesting functional linkage

  • Phylogenetic profiling:

    • Correlation of presence/absence patterns with other genes across species

  • Co-expression network analysis:

    • Integration with transcriptomic data from M. maripaludis to identify co-regulated genes

Based on preliminary analysis, UPF0290 proteins like MmarC5_1708 appear to have transmembrane helices and may function in membrane transport or signaling, potentially interacting with other membrane components in archaeal cells.

What techniques are most effective for studying protein-protein interactions involving MmarC5_1708?

For a membrane protein like MmarC5_1708, specialized techniques are required to identify and characterize protein-protein interactions:

TechniqueResolutionSample RequirementsAdvantagesLimitations
Crosslinking-MSAmino acid50-100 μg proteinIn vivo application possibleComplex data analysis
BN-PAGEProtein complex10-50 μg proteinPreserves native interactionsLimited resolution
Proximity labeling (BioID/APEX)Protein neighborhoodGenetic manipulationMaps spatial proximity in vivoRequires genetic tools for archaea
MST/SPRBinding kinetics10-50 μg purified proteinQuantitative binding dataRequires purified components
Co-IP/Pull-downBinary interactions50-100 μg protein extractRelatively simpleMay miss transient interactions

Methodological recommendations:

  • Begin with in silico interaction prediction using tools like STRING or BIOGRID to identify candidate interactors

  • For MmarC5_1708, consider a dual approach:

    • Chemical crosslinking combined with mass spectrometry to identify neighboring proteins in the native membrane

    • Affinity purification with quantitative proteomics using SILAC or TMT labeling to differentiate specific from non-specific interactions

  • Validate key interactions using techniques like:

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

    • Bimolecular fluorescence complementation (BiFC) if genetic tools are available for M. maripaludis

    • Reconstitution studies with purified components in nanodiscs or liposomes

How can I overcome solubility issues with recombinant MmarC5_1708?

Membrane proteins like MmarC5_1708 frequently present solubility challenges. Here's a systematic approach to address these issues:

  • Expression optimization:

    • Reduce expression temperature to 16-18°C to slow protein production

    • Use weaker promoters or lower inducer concentrations

    • Test C41/C43 E. coli strains specifically developed for membrane proteins

  • Fusion partners that enhance solubility:

Fusion PartnerSize (kDa)MechanismCleavage MethodSuccess Rate with Membrane Proteins
MBP42Chaperone-likeFactor Xa, TEV60-70%
SUMO11Folding enhancementSUMO protease50-60%
Mistic13Membrane integrationTEV40-50%
Truncated bacteriorhodopsin15Membrane targetingHRV 3C30-40%
  • Extraction optimization:

    • Screen detergent panel (DDM, LDAO, LMNG, UDM, OG) at various concentrations

    • Test mixed micelle systems (e.g., DDM with cholesterol hemisuccinate)

    • Consider bicelles or nanodiscs for native-like membrane environment

  • Buffer optimization:

    • Vary pH range (6.0-9.0)

    • Test different salt concentrations (100-500 mM)

    • Include glycerol (5-20%) or other stabilizing additives

  • Domain-based approach:

    • Analyze hydrophobicity plots to identify soluble domains

    • Create truncated constructs excluding highly hydrophobic regions

    • Test these constructs for improved solubility while maintaining function

Using the amino acid sequence of MmarC5_1708, transmembrane prediction algorithms suggest multiple membrane-spanning regions. Consider designing constructs that express individual soluble domains if full-length protein proves recalcitrant to solubilization .

What controls should be included in functional assays with MmarC5_1708?

Since MmarC5_1708 is an uncharacterized protein, functional assays require carefully designed controls:

  • Negative controls:

    • Empty vector/untransformed cells to establish baseline

    • Denatured protein sample to confirm activity requires native structure

    • Protein with inactivating mutations in predicted functional residues

    • Closely related protein from a different organism with known function

  • Positive controls:

    • Known protein with similar predicted structure/function

    • Native extract from M. maripaludis containing endogenous protein

  • Experimental validation controls:

    • Concentration gradients to establish dose-dependency

    • Time-course measurements to determine reaction kinetics

    • Temperature and pH variations to define optimal conditions

    • Substrate specificity panel to determine selectivity

  • Technical controls:

    • Multiple protein preparations to ensure reproducibility

    • Different expression tags to verify tag position doesn't affect function

    • Tag-free protein to confirm tag doesn't contribute to observed activity

For suspected membrane transport function, assay design might include:

  • Reconstitution in liposomes with fluorescent substrate analogs

  • Comparison with known transporters

  • Monitoring transport under varying electrochemical gradients

  • Use of specific inhibitors to classify transporter type

How does MmarC5_1708 compare to homologous proteins in other archaea?

Comparative analysis of MmarC5_1708 with homologs in other archaea provides valuable evolutionary and functional insights:

OrganismProtein AccessionIdentity (%)Similarity (%)Notable Features
M. jannaschiiQ582328291Additional C-terminal domain
M. vannieliiA6UQ177889Similar transmembrane topology
M. aeolicusA4FZ097185Shorter N-terminal region
Thermococcus kodakarensisQ5JI084368Additional cytoplasmic domain
Pyrococcus furiosusQ8U2F34165Thermostable variant

Phylogenetic analysis of UPF0290 proteins reveals several interesting patterns:

  • The protein family is widely distributed across methanogenic archaea but shows variable conservation in other archaeal lineages

  • Conservation is particularly high in the predicted transmembrane regions, suggesting functional importance of these domains

  • Variations in N- and C-terminal domains may reflect adaptation to different cellular environments or interaction partners

  • Proteins from thermophilic archaea show characteristic substitutions that likely contribute to thermostability (increased charged residues, reduced glycines)

  • The distribution pattern suggests the protein may be involved in methanogenesis-related processes or membrane adaptations specific to methanogenic lifestyles

What are the current hypotheses about the function of UPF0290 proteins?

Based on computational analysis and limited experimental data on UPF0290 family proteins, several hypotheses about their function have emerged:

  • Membrane transport hypothesis:

    • Structural features resemble small-molecule transporters

    • Conserved charged residues within transmembrane regions could form a substrate translocation pathway

    • May function in metabolite or ion transport across archaeal membranes

  • Membrane integrity hypothesis:

    • Pattern of conservation suggests a role in maintaining archaeal-specific membrane properties

    • Could function in lipid organization or membrane domain formation

    • May help adapt membranes to extreme conditions (temperature, pH, pressure)

  • Signaling hypothesis:

    • Potential sensor for environmental conditions

    • Conformational changes might transduce signals across membranes

    • Could interact with cytoplasmic signaling components

  • Methanogenesis-related hypothesis:

    • Enrichment in methanogenic archaea suggests involvement in methane metabolism

    • Might facilitate transport of methanogenesis substrates or products

    • Could sense redox conditions related to methanogenic pathways

The most promising approach to resolving these hypotheses would be:

  • Gene deletion studies in M. maripaludis

  • Lipidomic and metabolomic profiling of mutant strains

  • Protein-protein interaction studies to identify functional partners

  • Reconstitution of purified protein in defined membrane systems to test transport activity

How can I design site-directed mutagenesis experiments for functional studies of MmarC5_1708?

A systematic approach to site-directed mutagenesis can help elucidate structure-function relationships in MmarC5_1708:

  • Target residue selection based on:

    • Evolutionary conservation analysis using multiple sequence alignments

    • Predicted structural features from computational models

    • Characteristic motifs of related protein families

    • Predicted membrane topology

  • Suggested high-priority targets:

Residue PositionAmino AcidConservationPrediction BasisSuggested Mutation(s)
F51, F52, F60PhenylalanineHighPotential substrate bindingF→A, F→W, F→Y
Y45, Y131TyrosineHighPossible catalytic roleY→F, Y→A
R87, R88ArginineVery HighCharge relay or ion coordinationR→K, R→A, R→Q
D73, E74AcidicHighSalt bridge or ion bindingD/E→N/Q, D/E→A
G109, G141GlycineHighConformational flexibilityG→A, G→P
  • Mutation types to consider:

    • Conservative substitutions to maintain structure (e.g., D→E)

    • Non-conservative substitutions to abolish function (e.g., D→A)

    • Gain-of-function mutations based on homologs (e.g., substituting residues from thermophilic variants)

    • Cysteine substitutions for accessibility studies and crosslinking

  • Functional assay selection:

    • Expression level and membrane integration assessment

    • Thermal stability measurements using differential scanning fluorimetry

    • Binding assays if putative substrates are identified

    • In vivo complementation of deletion mutants

  • Data interpretation framework:

    • Establish clear phenotype categorization (null, partial, enhanced)

    • Correlation of mutations with structural models

    • Statistical analysis to distinguish significant from background effects

What are the best practices for long-term storage of purified MmarC5_1708?

Proper storage of membrane proteins like MmarC5_1708 is critical for maintaining structural integrity and functionality:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in purification buffer with appropriate detergent (typically 2-3× CMC)

    • Add stabilizing agents: 5-10% glycerol, 1 mM DTT or 5 mM β-mercaptoethanol

    • Include protease inhibitors (PMSF, EDTA, or commercial cocktail)

    • Filter sterilize (0.22 μm) to prevent microbial growth

  • Medium-term storage (1-3 months):

    • Storage at -20°C in buffer containing 20-50% glycerol

    • Flash freeze small aliquots (50-100 μL) to minimize freeze-thaw cycles

    • Include antioxidants (1 mM DTT, 0.5 mM TCEP)

    • Consider adding specific stabilizers (100-200 mM trehalose or sucrose)

  • Long-term storage (>3 months):

    • Flash freeze in liquid nitrogen and store at -80°C

    • Consider lyophilization for detergent-solubilized protein

    • Explore reconstitution into proteoliposomes or nanodiscs prior to freezing

  • Stability monitoring protocol:

    • Before experiments, verify protein integrity by:

      • SDS-PAGE to check for degradation

      • Size exclusion chromatography to assess aggregation

      • Dynamic light scattering to evaluate dispersity

      • Activity assay (when available) to confirm function

  • Recovery optimization:

    • Thaw samples rapidly at room temperature or 37°C water bath

    • Immediately place on ice once thawed

    • Centrifuge briefly (10,000 × g, 5 min) to remove any precipitate

    • For critical experiments, consider performing a "polishing" purification step

According to the product information, MmarC5_1708 can be stored at -20°C in a Tris-based buffer with 50% glycerol. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.