Recombinant Methanococcus maripaludis UPF0290 protein MmarC6_0973 (MmarC6_0973)

What is the structural composition of Methanococcus maripaludis UPF0290 protein MmarC6_0973?

The Methanococcus maripaludis UPF0290 protein MmarC6_0973 (UniProt ID: A9A8W5) is composed of 178 amino acids with the following sequence: MDLLLLLFSAIWYILPAYVANAVPCILGGGKPVDFGKTFFDGNRIIGNGVTYRGTFFGIL FGIIITGILQHFIVILYMGPETVFDYGLFGYIILSFLLASGTVFGDMLGSFIKRRFKLNQG QSAPILDQITFIVFALLFAYPFYPLATNSIVLLLVISPIIHFSSNIIAYKLHLKKVWW. The protein is expressed from the MmarC6_0973 gene in Methanococcus maripaludis strain C6 / ATCC BAA-1332. The expression region spans from amino acid positions 1-178 .

What are the optimal storage conditions for recombinant MmarC6_0973 protein samples?

For optimal preservation of protein integrity, recombinant MmarC6_0973 should be stored at -20°C, with extended storage preferably at -20°C or -80°C. The protein is typically stored in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. It is advisable to avoid repeated freezing and thawing cycles, which can compromise protein structure and function. For short-term work, maintaining working aliquots at 4°C for up to one week is recommended .

How does phosphate concentration affect gene expression in Methanococcus maripaludis?

Phosphate concentration serves as a critical regulatory factor for gene expression in M. maripaludis. Research has demonstrated that limiting phosphate conditions can significantly enhance protein expression. Specifically, expression levels of tagged proteins in M. maripaludis have been observed to increase 2.6-fold at 40 μM Pi and 3.3-fold at 80 μM Pi compared to expression at 800 μM Pi (high phosphate conditions). The optimal phosphate concentration range for maximizing gene expression has been determined to be between 80-150 μM initial Pi concentrations .

What experimental design methodology is most appropriate for optimizing recombinant MmarC6_0973 expression?

For optimizing recombinant MmarC6_0973 expression, a factorial experimental design is recommended to systematically evaluate multiple variables simultaneously. This approach should:

• Define independent variables: Key factors to manipulate include phosphate concentration, growth temperature, media composition, and induction timing.

• Establish dependent variables: Protein yield, purity, and functional activity are primary outcomes to measure.

• Control extraneous variables: Standardize inoculum density, pH, and oxygen exposure.

A true experimental design with control groups should be implemented to ensure that observed effects can be attributed to the manipulated variables rather than external factors. For example, expression under constitutive promoters like PhmvA can serve as controls when testing inducible systems like Ppst .

When using the phosphate-regulated expression system, evaluate protein production across a range of phosphate concentrations (e.g., 40, 80, 150, 400, and 800 μM Pi) to identify optimal conditions that balance growth and expression .

How can researchers effectively design experiments to evaluate MmarC6_0973 function in Methanococcus maripaludis?

To evaluate MmarC6_0973 function, implement a comparative experimental design that incorporates the following elements:

• Generate knockout mutants: Create MmarC6_0973 deletion strains using established genetic tools for M. maripaludis.

• Establish complementation systems: Design complementation vectors with varying expression levels using the phosphate-regulated promoter system to restore protein function.

• Implement phenotypic analysis: Compare growth rates, metabolite production, and stress responses between wild-type, knockout, and complemented strains.

• Measure physiological parameters: Monitor methane production rates, hydrogenase activity, and cellular ultrastructure.

For rigorous evaluation, employ randomization in experimental setup and include appropriate controls to mitigate the effects of confounding variables. When analyzing results, clearly distinguish between statistically significant and insignificant changes in the dependent variables being measured .

What controls should be included when expressing recombinant MmarC6_0973 in M. maripaludis?

When expressing recombinant MmarC6_0973, the following controls should be incorporated:

• Empty vector control: Transform M. maripaludis with the expression vector lacking the MmarC6_0973 gene to account for vector-related effects.

• Constitutive expression control: Express MmarC6_0973 under a constitutive promoter (e.g., PhmvA) to compare with phosphate-regulated expression.

• Wild-type strain: Include the parental strain without any recombinant constructs to establish baseline growth and physiological parameters.

• Tag-only control: Express the affinity tag alone (e.g., FLAG or Strep tag) to assess potential tag effects on cellular processes.

• Phosphate concentration gradient: Maintain cultures at different phosphate concentrations (40, 80, 150, 400, and 800 μM) to establish a response curve for expression optimization .

These controls enable researchers to differentiate between effects caused by recombinant protein expression versus those resulting from experimental manipulation or vector components .

How can researchers optimize affinity purification of recombinant MmarC6_0973?

Optimizing affinity purification of recombinant MmarC6_0973 requires a comprehensive approach addressing several critical factors:

• Tag selection and positioning: For MmarC6_0973, a tandem affinity purification (TAP) system combining 3XFLAG and Twin Strep tags has proven effective. Consider the impact of N-terminal versus C-terminal tag placement on protein folding and function.

• Buffer optimization: Develop a purification buffer that maintains protein stability:

  • Base buffer: 50 mM Tris-HCl, pH 7.5

  • Stabilizers: 10% glycerol, 1 mM DTT

  • Salt concentration: 150-300 mM NaCl (titrate to determine optimal concentration)

  • Protease inhibitors: Complete EDTA-free cocktail

• Cell lysis conditions: Given the archaeal membrane characteristics, optimize lysis using:

  • Mechanical disruption (French press) at 15,000 psi

  • Detergent supplementation (0.1% Triton X-100) for membrane-associated fractions

  • Anaerobic conditions to prevent oxidative damage

• Elution strategy: Implement a stepwise elution protocol with increasing concentrations of competitive agents (e.g., FLAG peptide or desthiobiotin) to separate high-affinity binders from weak/non-specific interactions .

To maximize yield from phosphate-regulated expression systems, harvest cells during late exponential phase when grown in 80 μM Pi media, which has been shown to provide optimal protein expression levels while maintaining good biomass yields .

What techniques are most effective for analyzing protein-protein interactions involving MmarC6_0973?

For investigating protein-protein interactions involving MmarC6_0973, multiple complementary approaches should be employed:

• Co-immunoprecipitation (Co-IP):

  • Express FLAG-tagged MmarC6_0973 in M. maripaludis under phosphate-regulated conditions

  • Perform pull-downs using anti-FLAG antibodies

  • Identify interacting partners by mass spectrometry

  • Validate interactions with reciprocal Co-IPs using antibodies against identified partners

• Proximity-dependent labeling:

  • Construct fusions of MmarC6_0973 with enzymes like BioID or APEX2

  • Express in M. maripaludis at low phosphate concentrations (80 μM Pi)

  • Identify proximal proteins through biotinylation and streptavidin pull-downs

  • Compare interactomes under different growth conditions

• In vitro reconstitution assays:

  • Express and purify recombinant MmarC6_0973 and potential partners

  • Perform analytical size exclusion chromatography

  • Use thermophoresis or surface plasmon resonance to determine binding parameters

When interpreting interaction data, carefully discriminate between direct binding partners and proteins that co-localize but do not directly interact. Cross-validate findings using multiple techniques and include appropriate negative controls (e.g., irrelevant proteins of similar size/structure) .

What are the recommended approaches for determining the subcellular localization of MmarC6_0973?

Determining the subcellular localization of MmarC6_0973 requires specialized approaches for archaeal systems:

• Fluorescence microscopy:

  • Create C-terminal fusions with fluorescent proteins optimized for archaeal expression

  • Express under the native or phosphate-regulated promoter at 80-150 μM Pi

  • Image cells using structured illumination or confocal microscopy

  • Co-localize with known compartment markers

• Subcellular fractionation:

  • Separate cytoplasmic, membrane, and nucleoid fractions through differential centrifugation

  • Analyze fractions by Western blot using anti-MmarC6_0973 antibodies or tag-specific antibodies

  • Include marker proteins for each cellular compartment as controls

  • Quantify distribution across fractions using densitometry

• Immuno-electron microscopy:

  • Fix cells using techniques that preserve archaeal ultrastructure

  • Label with gold-conjugated antibodies against MmarC6_0973 or its tag

  • Analyze distribution pattern relative to cellular structures

When performing localization studies, consider that the amino acid sequence of MmarC6_0973 suggests membrane association with hydrophobic regions that may influence its cellular distribution. The sequence (MDLLLLLFSAIWYILPAYVANAVPCILGGGKPVDFGKTFFDGNRIIGNGVTYRGTFFGIL FGIIITGILQHFIVILYMGPETVFDYGLFGYIILSFLLASGTVFGDMLGSFIKRRFKLNQG QSAPILDQITFIVFALLFAYPFYPLATNSIVLLLVISPIIHFSSNIIAYKLHLKKVWW) contains stretches of hydrophobic residues consistent with membrane protein characteristics .

How should researchers analyze Western blot data for quantifying MmarC6_0973 expression levels?

Quantitative analysis of Western blot data for MmarC6_0973 expression requires rigorous methodology:

• Sample preparation standardization:

  • Normalize total protein concentration across samples (20-50 μg per lane)

  • Include serial dilutions of purified recombinant protein as standards

  • Process all samples simultaneously to minimize technical variation

• Blotting controls:

  • Include a constitutively expressed archaeal protein (e.g., elongation factor 1α) as a loading control

  • Run a phosphate-independent reference protein to normalize for growth effects

  • Include positive controls from previously characterized conditions

• Quantification procedure:

  • Capture images within the linear dynamic range of detection

  • Use densitometry software to quantify band intensity

  • Correct for background signal

  • Normalize to loading controls

  • Calculate fold-changes relative to reference conditions (e.g., high phosphate at 800 μM Pi)

Table 1: Example Quantification of MmarC6_0973 Expression Levels

When reporting results, clearly distinguish between statistically significant and insignificant changes. Reserve terms like "increased" or "decreased" for changes that have been statistically verified .

What statistical approaches are appropriate for analyzing growth and expression data from MmarC6_0973 studies?

For analyzing growth and expression data in MmarC6_0973 studies, implement these statistical approaches:

• Growth curve analysis:

  • Fit growth data to appropriate models (logistic, Gompertz)

  • Extract parameters: maximum growth rate, lag phase duration, final cell density

  • Compare parameters using ANOVA with post-hoc tests

  • Plot confidence intervals rather than simple error bars

• Expression data analysis:

  • For multi-factorial experiments (e.g., varying phosphate and temperature)

  • Use two-way ANOVA to assess main effects and interactions

  • Implement Tukey's HSD for pairwise comparisons

  • Calculate effect sizes (e.g., Cohen's d) to quantify magnitude of differences

• Correlation analysis:

  • Assess relationship between expression levels and physiological parameters

  • Calculate Pearson's correlation coefficients for normally distributed data

  • Implement Spearman's rank correlation for non-parametric relationships

  • Generate scatterplots with regression lines and confidence bands

• Biological replication:

  • Perform experiments with at least three biological replicates

  • Calculate both biological and technical variability

  • Report both p-values and confidence intervals

  • Consider power analysis to determine appropriate sample sizes

When reporting statistical results, clearly describe the tests used, p-value thresholds, and whether assumptions of each test were met (e.g., normality, homoscedasticity) .

How does the UPF0290 protein family function in archaeal membrane biology?

The UPF0290 protein family, which includes MmarC6_0973, appears to play significant roles in archaeal membrane biology, though detailed functional characterization remains incomplete. Based on sequence analysis, MmarC6_0973 contains multiple transmembrane domains and hydrophobic regions (MDLLLLLFSAIWYILPAYVANAVPCILGGGKPVDFGKTFFDGNRIIGNGVTYRGTFFGIL FGIIITGILQHFIVILYMGPETVFDYGLFGYIILSFLLASGTVFGDMLGSFIKRRFKLNQG QSAPILDQITFIVFALLFAYPFYPLATNSIVLLLVISPIIHFSSNIIAYKLHLKKVWW), suggesting membrane association .

For researchers investigating UPF0290 function, consider these methodological approaches:

• Comparative genomics:

  • Analyze conservation patterns across archaeal lineages

  • Identify synteny relationships that may indicate functional associations

  • Examine co-evolution with specific metabolic pathways

• Transcriptomic profiling:

  • Compare expression patterns under varying conditions (temperature, pH, nutrient limitation)

  • Identify co-expressed genes that may function in related processes

  • Analyze promoter regions for shared regulatory elements

• Lipidomic analysis:

  • Compare membrane lipid composition between wild-type and MmarC6_0973 mutants

  • Assess changes in membrane fluidity and permeability

  • Investigate alterations in lipid domain organization

To address the function of this protein family, design experiments that specifically probe membrane-associated processes, including transport activities, stress responses, and interactions with other membrane proteins .

What are the challenges in developing an efficient expression system for functional studies of MmarC6_0973?

Developing efficient expression systems for MmarC6_0973 functional studies presents several challenges requiring specific methodological solutions:

• Archaeal-specific translational machinery:

  • Problem: Standard bacterial expression systems may not properly process archaeal proteins

  • Solution: Optimize codon usage for the host organism or develop archaeal-based expression systems

  • Method: Implement the phosphate-regulated promoter system (Ppst) in M. maripaludis which has shown 3-4 fold increased expression under Pi limitation

• Post-translational modifications:

  • Problem: Heterologous systems may not reproduce archaeal-specific modifications

  • Solution: Express in closely related archaeal hosts or engineer systems to incorporate necessary modification machinery

  • Method: Utilize homologous expression in M. maripaludis with optimized 5′ UTR modifications that can increase expression by 2.5-fold while maintaining phosphate responsiveness

• Protein toxicity:

  • Problem: Constitutive high-level expression may be toxic to host cells

  • Solution: Implement inducible or regulated expression systems

  • Method: Use the phosphate-regulated system which delays peak expression until late in growth, allowing biomass accumulation before high-level protein production

• Functional assay development:

  • Problem: Unknown function makes activity assays difficult to establish

  • Solution: Develop phenotypic screens and proxies for function

  • Method: Measure growth parameters, stress resistance, and membrane integrity in strains with varying expression levels

The phosphate-regulated expression system has proven particularly valuable, allowing expression levels of up to 6% of total cellular protein while minimizing growth inhibition that might otherwise occur with constitutive high-level expression systems .

How might MmarC6_0973 interact with the methanogenesis pathway in M. maripaludis?

Investigating potential interactions between MmarC6_0973 and the methanogenesis pathway requires multifaceted experimental approaches:

• Co-expression analysis:

  • Examine transcriptional coordination between MmarC6_0973 and methanogenesis genes

  • Monitor expression changes in response to methanogenic substrates (H2, CO2, formate)

  • Analyze expression patterns during adaptation to different growth conditions

• Metabolic impact assessment:

  • Measure methane production rates in MmarC6_0973 overexpression and knockout strains

  • Quantify intermediate metabolites of methanogenesis using liquid chromatography-mass spectrometry

  • Monitor isotope incorporation patterns using 13C-labeled substrates

• Protein-protein interaction studies:

  • Screen for physical interactions with key methanogenesis enzymes, particularly MCR (methyl-coenzyme M reductase)

  • Investigate potential associations with membrane-bound hydrogenases

  • Examine co-localization with F420-reducing complexes

While direct evidence linking MmarC6_0973 to methanogenesis is currently limited, its membrane localization makes it a candidate for roles in substrate acquisition, energy coupling, or maintenance of membrane potential required for methanogenic processes. The established expression system for MCR, which represents up to 6% of total protein when optimized, provides a methodological framework for similar studies with MmarC6_0973 .

What strategies can address low yields when purifying recombinant MmarC6_0973?

When encountering low yields during purification of recombinant MmarC6_0973, implement these systematic troubleshooting strategies:

• Expression optimization:

  • Verify phosphate concentration is within optimal range (80-150 μM Pi)

  • Adjust harvest timing to late exponential phase

  • Confirm promoter and 5′ UTR sequences match the optimized versions reported to increase expression by 2.5-fold

  • Monitor expression via Western blot throughout growth to identify peak production

• Solubility enhancement:

  • Test different lysis buffers with varying salt concentrations (150-500 mM)

  • Include mild detergents (0.5-2% Triton X-100, 0.1-0.5% DDM, or 0.5-2% CHAPS)

  • Add stabilizing agents (5-10% glycerol, 1-5 mM reducing agents)

  • Perform lysis and purification under strictly anaerobic conditions

• Purification optimization:

  • Evaluate different affinity tag systems (His, FLAG, Strep, or combinations)

  • Implement tandem affinity purification to increase purity

  • Test on-column refolding if inclusion bodies are forming

  • Optimize elution conditions (pH, imidazole concentration, or competitive elution)

• Storage stability:

  • Verify storage buffer composition is optimized for the specific protein

  • Test protein stability at different temperatures (-80°C, -20°C, 4°C)

  • Evaluate additives that prevent aggregation (glycerol, arginine, trehalose)

For membrane-associated proteins like MmarC6_0973, additional considerations include the choice of detergent for extraction from membranes and maintaining an environment that prevents aggregation during purification steps .

How can researchers address variability in phosphate-regulated expression systems for MmarC6_0973?

To address variability in phosphate-regulated expression systems for MmarC6_0973, implement these methodological controls and standardization procedures:

• Media preparation standardization:

  • Use defined media with precisely controlled phosphate concentrations

  • Prepare large batches of base media and add phosphate separately to ensure consistency

  • Verify phosphate concentrations analytically before and during experiments

  • Account for phosphate contributed by inoculum by washing cells in phosphate-free media

• Growth condition controls:

  • Maintain strict temperature control (±0.5°C) throughout growth

  • Standardize inoculum density and growth phase

  • Monitor and maintain consistent pH throughout growth period

  • Establish uniform mixing/agitation protocols for all cultures

• Quantification standardization:

  • Implement internal standards for Western blot quantification

  • Use recombinant protein standards for absolute quantification

  • Include constitutively expressed control proteins for normalization

  • Perform technical replicates with multiple sample dilutions to ensure linearity

• Statistical approaches for variance control:

  • Calculate coefficients of variation across experiments

  • Implement outlier detection methods with clear inclusion/exclusion criteria

  • Use statistical tests appropriate for the observed data distribution

  • Report variability explicitly with confidence intervals rather than simple error bars

Table 2: Impact of Standardization Procedures on Experimental Variability

What are the emerging research directions for understanding UPF0290 proteins in archaea?

Emerging research directions for UPF0290 proteins in archaea are focusing on integrating multiple levels of biological investigation to elucidate their functional significance. Key methodological approaches include:

• Systems biology integration:

  • Multi-omics studies combining transcriptomics, proteomics, and metabolomics

  • Network analysis to position UPF0290 proteins within archaeal cellular processes

  • Comparative genomics across diverse archaeal lineages to identify functional conservation patterns

• Structure-function relationships:

  • Cryo-EM and X-ray crystallography to determine three-dimensional structures

  • Molecular dynamics simulations to predict membrane interactions

  • Structure-guided mutagenesis to identify critical functional domains

• Ecological context exploration:

  • Investigation of expression patterns under environmentally relevant conditions

  • Analysis of UPF0290 proteins in archaeal communities via metaproteomics

  • Examination of selective pressures on UPF0290 genes in different habitats

• Biotechnological applications:

  • Development of archaeal expression systems using phosphate regulation

  • Engineering membrane proteins for enhanced stability in biotechnological applications

  • Utilizing archaeal systems for production of challenging recombinant proteins

The optimization of expression systems has already demonstrated that phosphate-regulated promoters can achieve 6% of total cellular protein expression, representing a 140% increase over constitutive promoters like PhmvA. These tools provide a foundation for deeper investigation of UPF0290 proteins and their roles in archaeal biology .

Through systematic application of these methodological approaches, researchers can address the significant knowledge gaps regarding UPF0290 proteins like MmarC6_0973, ultimately advancing our understanding of archaeal biology and potentially revealing novel biological principles with broader implications.