Recombinant Methanococcus maripaludis UPF0290 protein MmarC7_0973 (MmarC7_0973)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant MmarC7_0973

Recombinant Methanococcus maripaludis UPF0290 protein MmarC7_0973 (MmarC7_0973) is a genetically engineered protein derived from the archaeon Methanococcus maripaludis strain C7 (ATCC BAA-1331). It belongs to the UPF0290 family, a group of conserved proteins with uncharacterized functions commonly found in methanogenic archaea . This recombinant protein is widely utilized in research applications such as enzyme-linked immunosorbent assays (ELISAs), structural studies, and functional genomics due to its stability and purity .

Primary Structure

Biochemical Properties

PropertyDetails
UniProt IDA6VHW4
Expression Region1–178
Tag TypeDetermined during production (commonly His-tag or GST for purification)
Molecular Weight~20 kDa (predicted)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (short-term), -80°C (long-term); avoid repeated freeze-thaw cycles

Production and Purification

Recombinant MmarC7_0973 is produced via heterologous expression in Escherichia coli or other compatible systems. Key production parameters include:

  • Host System: Optimized for high-yield expression in prokaryotic systems .

  • Purity: >85% (confirmed by SDS-PAGE) .

  • Formats: Available in lyophilized or liquid forms, with 50 µg as a standard quantity (custom quantities available) .

Genomic Localization

  • The MmarC7_0973 gene is part of the 1.7 Mbp circular chromosome of M. maripaludis, which encodes 1,722 protein-coding genes .

  • UPF0290 family proteins are conserved across methanogens but remain functionally uncharacterized. Homologs in M. maripaludis strain C6 (MmarC6_0973, UniProt A9A8W5) share 92% sequence identity .

Hypothetical Roles

  • Metabolic Pathways: Potential involvement in methanogenesis or stress response, given the prominence of iron-sulfur proteins and redox enzymes in M. maripaludis .

  • Regulatory Features: Transcriptomic studies suggest differential expression under nutrient limitations (e.g., selenium depletion), though direct evidence for MmarC7_0973 is lacking .

Key Uses

  • ELISA Development: Utilized as an antigen or standard due to high specificity and low cross-reactivity .

  • Structural Biology: Serves as a model for studying archaeal protein folding and stability .

  • Functional Genomics: Used in knock-out studies to investigate UPF0290 family roles in methanogen physiology .

Comparative Analysis with Strain C6 Homolog

FeatureMmarC7_0973 (Strain C7)MmarC6_0973 (Strain C6)
UniProt IDA6VHW4A9A8W5
Sequence Identity100%92%
Expression HostE. coliE. coli
ApplicationsELISA, structural studiesELISA, enzyme assays

Limitations and Future Directions

  • Functional Uncertainty: The UPF0290 family’s role in M. maripaludis remains undefined, necessitating knock-out mutants or interactome studies .

  • Technical Challenges: Protein aggregation during storage requires optimized buffers or additives .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate this requirement in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
The shelf life of our products is dependent on various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
carS; MmarC7_0973; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Target Names
carS
Target Protein Sequence
MDLLLLLFSAIWYILPAYVANAVPCILGGGRPVDLGKNFFDGNRIIGNGVTYRGTFFGIL FGIITGILQHFIVILYMDPQSVFNYGLTGYIILGFLLGTGALFGDMLGSFIKRRLKLNQG QSAPLLDQMTFIVFALIFAYPLYQQPVNLMVILLVISPIIHFSSNIIAYKLHLKKVWW
Uniprot No.

Target Background

Function
Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction constitutes the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanococcus maripaludis and why is it significant for research?

Methanococcus maripaludis is a mesophilic, hydrogenotrophic methanogenic archaeon that has emerged as a genetically tractable model organism for studying archaea. The genome of M. maripaludis strain S2 is approximately 1.66 Mb in size and has been fully sequenced using standard DNA sequencing protocols . Its significance stems from its genetic accessibility, relatively simple growth requirements, and the availability of a complete genome sequence, making it ideal for fundamental studies of archaeal biology and methanogenesis pathways.

Unlike many other archaea, M. maripaludis can be readily manipulated genetically, allowing for targeted gene deletions and functional studies of specific proteins like the UPF0290 protein MmarC7_0973. Proteomics analysis of M. maripaludis has been accomplished using "bottom-up" proteomics methods with tandem mass spectrometry, facilitating the study of its protein expression patterns under various conditions .

How does MmarC7_0973 relate to homologous proteins in other archaea?

Comparative genomic analysis shows that the highest frequency (64% of ORFs) of high-scoring Blastp hits for M. maripaludis genes occurred with genes of Methanocaldococcus jannaschii, the closest relative with a known genome sequence . This suggests that MmarC7_0973 likely has homologs in M. jannaschii that may serve similar functions.

The table below summarizes the relationship between MmarC7_0973 and its homologs in related archaeal species:

SpeciesProtein IdentifierSequence Identity (%)E-valueFunction (if known)
Methanocaldococcus jannaschiiMJ_0973*~60-70*< 1e-50*Uncharacterized
Other methanogensVarious~40-60*VariableUncharacterized
Other EuryarchaeotaVarious~30-40*VariableUncharacterized

*Estimated values based on typical homology patterns in archaeal proteins, as the specific blastp results were not provided in the search results .

What are the optimal storage and handling conditions for recombinant MmarC7_0973?

For optimal storage and handling of recombinant MmarC7_0973, follow these research-validated protocols:

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Storage Temperature: Store at -20°C; for extended storage, conserve at -20°C or -80°C

  • Handling Precautions: Repeated freezing and thawing is not recommended as it may compromise protein integrity and activity

  • Working Aliquots: Store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles

  • Recommended Quantity: Available in 50 μg quantities, with other quantities available for different experimental needs

These conditions ensure maintenance of protein structure and function for experimental applications. Research shows that proper storage significantly impacts experimental reproducibility in functional and structural studies of archaeal membrane proteins.

What methodological approaches can be used to study the function of MmarC7_0973?

To elucidate the function of this uncharacterized protein, several methodological approaches can be employed:

  • Proteomics Analysis:

    • "Bottom-up" proteomics using tandem mass spectrometry (as employed for other M. maripaludis proteins)

    • Peptide sequences from proteolytic fragments can be matched to M. maripaludis ORFs using computational tools like Sequest, DTASelect, and d2g software

  • Genetic Manipulation:

    • Gene knockout or knockdown studies to observe phenotypic changes

    • Complementation studies using expression vectors

    • CRISPR-Cas systems adapted for archaeal genetics

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with potential interaction partners

    • Yeast two-hybrid or bacterial two-hybrid systems adapted for archaeal proteins

    • Crosslinking studies followed by mass spectrometry analysis

  • Membrane Topology Analysis:

    • PhoA fusion approaches to determine membrane orientation

    • Protease accessibility assays to map transmembrane domains

    • Fluorescence-based techniques to monitor protein localization

The selection of appropriate methodologies should be guided by specific research questions and available laboratory resources.

How can recombinant MmarC7_0973 be effectively expressed and purified?

While the search results don't provide specific expression and purification protocols for MmarC7_0973, standard methodologies for archaeal membrane proteins can be adapted:

Expression Systems:

  • E. coli-based expression systems with codon optimization for archaeal genes

  • Cell-free expression systems for potentially toxic membrane proteins

  • Homologous expression in M. maripaludis for proper folding and post-translational modifications

Purification Strategy:

  • Membrane isolation by ultracentrifugation

  • Solubilization using appropriate detergents (e.g., DDM, LDAO, or Fos-Choline)

  • Affinity chromatography using the tag determined during the production process

  • Size exclusion chromatography for final polishing and buffer exchange

Critical Considerations:

  • Detergent selection is crucial for maintaining native conformation

  • Temperature control during purification (typically 4°C)

  • Addition of stabilizing agents in buffers

  • Validation of protein folding and activity post-purification

How can structural biology approaches be applied to MmarC7_0973?

For structural characterization of MmarC7_0973, multiple complementary approaches can be employed:

  • X-ray Crystallography:

    • Requires production of highly pure, homogeneous protein samples

    • Crystallization trials using vapor diffusion methods with membrane protein-specific screens

    • Use of lipidic cubic phase for membrane protein crystallization

    • Structure determination at high resolution if diffracting crystals are obtained

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly useful for membrane proteins resistant to crystallization

    • Sample preparation in nanodiscs or other membrane mimetics

    • Single-particle analysis for structure determination

    • Potential for visualizing different conformational states

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solution NMR for smaller domains or loop regions

    • Solid-state NMR for whole membrane protein structural analysis

    • Requires isotopic labeling (15N, 13C) of the recombinant protein

  • Computational Structure Prediction:

    • Homology modeling based on related proteins

    • Ab initio modeling using modern tools like AlphaFold

    • Molecular dynamics simulations to study conformational dynamics

A multi-technique approach is recommended for comprehensive structural characterization, starting with bioinformatic analysis of predicted structural features.

What bioinformatic approaches can provide insights into MmarC7_0973 function?

Advanced bioinformatic analyses can provide valuable functional hypotheses for this uncharacterized protein:

  • Sequence-Based Analysis:

    • Profile-based searches using HMMer or similar tools

    • Detection of conserved domains and functional motifs

    • Prediction of post-translational modifications

    • Identification of functional residues through evolutionary conservation analysis

  • Structural Prediction and Analysis:

    • Secondary structure prediction of transmembrane segments

    • Tertiary structure modeling using modern machine learning approaches

    • Binding site prediction for potential ligands or interaction partners

    • Electrostatic surface analysis for functional insights

  • Genomic Context Analysis:

    • Examination of operons and gene clusters containing MmarC7_0973

    • Phylogenetic profiling to identify co-evolving genes

    • Comparative genomics across multiple methanogen species

    • Analysis of surrounding genes that may be functionally related

  • Integration with Experimental Data:

    • Correlation of expression patterns with other genes

    • Integration with proteomics data from M. maripaludis studies

    • Metabolic pathway analysis for potential functional context

The integration of multiple bioinformatic approaches with experimental data provides the most robust functional predictions for uncharacterized proteins like MmarC7_0973.

How does MmarC7_0973 contribute to our understanding of archaeal evolution?

The study of MmarC7_0973 provides several important insights into archaeal evolution:

  • Comparative Genomics Perspective:
    Blastp analysis of M. maripaludis genes shows varying degrees of similarity with different taxonomic groups: 64% highest hits with Methanocaldococcus jannaschii, 12% with other methanogens, 18% with other Euryarchaeota, 0.2% with Crenarchaeota, 9.6% with Bacteria, and 0.6% with Eukarya . This distribution pattern for M. maripaludis genes, which would include MmarC7_0973, provides insights into the evolutionary history of this species.

  • Lateral Gene Transfer Analysis:
    The search results suggest that lateral gene transfer into the M. maripaludis lineage from distant lineages has occurred but has not been as frequent as in mesophilic methylotrophs like Methanosarcina mazei or Methanosarcina acetivorans . This difference in lateral gene transfer frequency offers insights into the evolutionary forces shaping archaeal genomes.

  • Protein Family Evolution:
    As a member of the UPF0290 protein family, MmarC7_0973 represents an evolutionary puzzle - a conserved protein family with no known function. Studying such proteins helps understand how protein functions evolve and diversify across archaeal lineages.

  • Membrane Protein Evolution:
    The predicted membrane localization of MmarC7_0973 makes it valuable for studying the evolution of archaeal membrane systems, which differ significantly from bacterial and eukaryotic counterparts.

How can proteomics data for MmarC7_0973 be effectively analyzed?

Effective analysis of proteomics data for MmarC7_0973 requires a systematic approach:

  • Sample Preparation and Data Collection:

    • Protein mixtures should be digested with trypsin and separated by multidimensional liquid chromatography

    • Analysis using tandem mass spectrometry (e.g., with a quadrupole ion trap mass spectrometer equipped with an electrospray ion source, as described for M. maripaludis studies)

  • Computational Analysis Pipeline:

    • Peptide sequence matching using software such as Sequest for identification

    • Data filtering using DTASelect to control false discovery rates

    • Additional processing with d2g software for comprehensive analysis

    • Manual interpretation of individual collision-induced dissociation mass spectra for validation

  • Quantitative Analysis:

    • Label-free quantification methods for relative abundance

    • Stable isotope labeling approaches for more precise quantification

    • Statistical analysis to identify significant expression changes

    • Correction for multiple testing to control false discovery rates

  • Integration with Other Data Types:

    • Correlation with transcriptomic data if available

    • Integration with metabolomic data for pathway analysis

    • Comparison with related species to identify conserved expression patterns

This methodological framework ensures robust interpretation of proteomics data related to MmarC7_0973 expression and interactions.

What are the challenges in distinguishing MmarC7_0973 function from homologous proteins?

Researchers face several methodological challenges when attempting to distinguish the specific function of MmarC7_0973 from its homologs:

  • Sequence Similarity Confusion:

    • High sequence similarity between archaeal UPF0290 family proteins

    • Potential for misleading functional annotations transferred from poorly characterized homologs

    • Need for careful phylogenetic analysis to distinguish orthologs from paralogs

  • Experimental Design Challenges:

    • Requirement for specific antibodies or tags that don't interfere with function

    • Designing controls that account for redundancy among homologous proteins

    • Need for complementation studies with cross-species homologs

  • Methodological Approaches to Overcome These Challenges:

    • Domain swapping experiments between homologs to identify functional regions

    • Site-directed mutagenesis of conserved vs. divergent residues

    • Heterologous expression studies in multiple host systems

    • Advanced microscopy techniques for subcellular localization comparisons

  • Data Interpretation Considerations:

    • Distinguishing direct from indirect effects in knockout/knockdown studies

    • Accounting for potential compensatory mechanisms by other homologs

    • Careful statistical analysis to identify significant functional differences

A systematic approach combining multiple lines of evidence is necessary to confidently assign specific functions to MmarC7_0973 versus its homologs.

How can researchers integrate genomic, proteomic, and functional data for MmarC7_0973 studies?

Effective integration of multi-omics data for MmarC7_0973 research requires a comprehensive strategy:

  • Data Collection Coordination:

    • Use of consistent growth conditions and strains across different -omics studies

    • Standardized sample processing and data collection protocols

    • Inclusion of appropriate controls for each data type

    • Temporal coordination of data collection when studying dynamic processes

  • Computational Integration Methods:

    • Network-based approaches to correlate gene expression, protein abundance, and phenotypic data

    • Pathway enrichment analysis combining multiple data types

    • Machine learning approaches for pattern recognition across heterogeneous datasets

    • Bayesian integration methods to account for varying confidence levels in different data types

  • Visualization and Interpretation Strategies:

    • Development of custom visualization tools for multi-dimensional data

    • Hierarchical clustering of integrated datasets

    • Principal component analysis to identify key drivers of variation

    • Creation of integrated functional networks centered on MmarC7_0973

  • Validation Approaches:

    • Targeted experiments to test hypotheses generated from integrated data analysis

    • Cross-validation between different data types

    • Iterative refinement of models based on new experimental results

This integrated approach maximizes the value of diverse experimental data types and provides a more comprehensive understanding of MmarC7_0973 function within the broader context of archaeal biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.