Recombinant Methanococcus maripaludis UPF0290 protein MMP1698 (MMP1698) is a hypothetical protein encoded by the MMP1698 gene in the archaeon Methanococcus maripaludis (strain S2/LL). The genome of M. maripaludis contains 1,722 protein-coding genes, with MMP1698 classified under the UPF0290 family of uncharacterized conserved proteins . This protein is annotated as a conserved hypothetical protein with no experimentally confirmed enzymatic or structural role .
| Parameter | Value |
|---|---|
| UniProt ID | Q6LWL1 |
| Gene Name | MMP1698 (Ordered Locus Name) |
| Organism | Methanococcus maripaludis S2/LL |
| Protein Length | 178 amino acids (full-length) |
| Molecular Weight | ~20 kDa (predicted) |
While MMP1698 remains uncharacterized functionally, its genomic neighborhood and homologs in related methanogens suggest potential roles in membrane-associated processes or stress response . M. maripaludis is a model archaeon for hydrogenotrophic methanogenesis studies, with advanced genetic tools enabling proteomic and transcriptomic analyses . Quantitative proteomics studies comparing wild-type and mutant strains (e.g., S40) have identified differential expression patterns in hypothetical proteins like MMP1698, hinting at regulatory roles under specific metabolic conditions .
The M. maripaludis genome exhibits 33.1% GC content and encodes 38 tRNAs, 3 rRNA operons, and 350 predicted transmembrane proteins . MMP1698 is one of 129 unique ORFs in M. maripaludis with no homologs outside methanococci, underscoring its lineage-specific evolution .
Located in a gene-dense region (1.036 genes/kb).
No adjacent regulatory elements or co-expressed partners identified in current annotations .
Further studies leveraging CRISPR-based mutagenesis or heterologous expression systems could elucidate MMP1698’s function. Integration with metabolic network models of M. maripaludis may clarify its potential involvement in methanogenesis or stress adaptation pathways.
KEGG: mmp:MMP1698
STRING: 267377.MMP1698
MMP1698 is a protein encoded by the MMP1698 gene in Methanococcus maripaludis, an archaeal organism that serves as a significant model for studying methanogenic archaea. The protein belongs to the UPF0290 family, with a full amino acid sequence of 178 residues. Its structure includes several hydrophobic regions suggesting membrane association, with a sequence that includes "MDLLLLLFSALWYILPAYVANAVPCILGGGKPVDFGKNFFDGNRIIGNGVTYRGTFFGIL FGIITGILQHFIVILYMGPKSVFNYGLTGYIILSFLLATGALFGDMLGSFIKRRFNLNQG QSAPLLDQITFIIFALLFAYSLYPVPANIIVLLLVISPIIHFSSNIIAYKLHLKKVWW" . The protein is cataloged in UniProt under accession number Q6LWL1, providing researchers with standardized reference information for cross-study comparisons.
M. maripaludis has become one of the most extensively studied model organisms among obligate hydrogenotrophic methanogens due to several key advantages for researchers. It possesses a well-established genetic manipulation system, including transformation capabilities with various shuttle vectors and genome editing techniques . The organism can be transformed with multiple shuttle vector systems and its genome can be modified using integrative plasmids, markerless mutagenesis procedures, and more recently, CRISPR-mediated genome editing systems . These molecular tools have facilitated diverse studies of methanogen physiology and enabled metabolic engineering applications. Additionally, M. maripaludis has relatively simple growth requirements and faster doubling times compared to many other methanogens, making it experimentally tractable for laboratory studies focused on archaeal metabolism, genetics, and biochemistry .
Based on the protein's amino acid sequence analysis, MMP1698 contains multiple hydrophobic regions and transmembrane domains, strongly suggesting it functions as a membrane-associated protein . The presence of these hydrophobic stretches and its classification in the UPF0290 family (Uncharacterized Protein Family 0290) indicates potential roles in membrane transport, signaling, or structural integrity. While the precise function remains to be fully characterized, computational predictions suggest it may participate in processes related to methanogenesis, cellular adaptation to environmental stressors, or maintenance of archaeal membrane properties. Research examining protein-protein interactions or knockout phenotypes would be valuable for elucidating its specific biological function.
Achieving high yields of M. maripaludis biomass requires careful optimization of cultivation parameters. Research has demonstrated successful cultivation through a scale-up pipeline beginning with 0.05 L serum bottles (SB), followed by 0.4 L Schott bottle cultures (SCB), and finally 1.5 L bioreactor cultures . For serum bottle cultures, agitation by stirring at 500 rpm and supplementation with H₂/CO₂ (4:1) at 2 bars once daily produces effective growth . For larger Schott bottle cultures, shaking at 180 rpm with twice-daily H₂/CO₂ feeding at 1 bar pressure yields good results . In bioreactor settings, a stepwise conservative agitation profile with careful monitoring of pH and redox potential has achieved the highest reported optical density (OD₅₇₈) of 3.38 . Temperature should be maintained at 37°C across all cultivation methods. This optimized approach has demonstrated doubling times of 4-5 hours and represents a significant advancement in biomass production for this organism .
Proper storage of recombinant MMP1698 protein is critical for maintaining its structural integrity and biological activity. The recommended storage conditions include keeping the protein at -20°C for routine use, while extended storage should be at -20°C or preferably -80°C to minimize degradation . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to enhance stability . To prevent protein damage from freeze-thaw cycles, it's advisable to aliquot the stock solution into smaller volumes before freezing. Working aliquots can be stored at 4°C for up to one week, but longer periods at this temperature may lead to activity loss . Researchers should avoid repeated freezing and thawing, as this can cause protein denaturation and aggregation, potentially compromising experimental outcomes.
For successful production of recombinant MMP1698, researchers have developed specific expression and purification methodologies tailored to this archaeal protein. Expression in E. coli systems requires codon optimization and careful temperature control, typically employing strains designed for membrane protein expression. For purification, a multi-step approach is recommended, beginning with cell lysis under anaerobic conditions followed by membrane fraction isolation through differential centrifugation. Affinity chromatography using histidine tags has proven effective, though tag placement requires careful consideration to avoid interfering with protein folding and function. Size exclusion chromatography as a final polishing step enhances purity. Throughout purification, maintaining a reducing environment with agents like DTT or β-mercaptoethanol is crucial to prevent oxidation of cysteine residues. Protein identity and purity should be verified through techniques such as SDS-PAGE, Western blotting, and mass spectrometry before experimental use.
Structural characterization of MMP1698 presents both challenges and opportunities for archaeal membrane protein research. X-ray crystallography approaches require optimization of detergent screening to identify conditions that maintain native protein conformation while promoting crystal formation. For cryo-electron microscopy (cryo-EM), reconstitution into nanodiscs or amphipols has shown promise for preserving the native environment of archaeal membrane proteins. Nuclear magnetic resonance (NMR) studies may be particularly valuable for examining dynamic regions and interactions with other biomolecules. Researchers can prepare samples by expressing isotopically labeled protein (¹⁵N, ¹³C) in minimal media supplemented with labeled precursors. Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy offers another approach for investigating membrane topology and conformational changes. These structural studies would significantly advance understanding of protein folding and stability in extremophilic organisms, potentially revealing adaptations that allow functioning in methanogens' unique cellular environments.
Recent advances in genetic manipulation tools for M. maripaludis have created multiple options for studying MMP1698 function in vivo. The most cutting-edge approach utilizes CRISPR-Cas systems adapted for archaeal hosts, with two distinct CRISPR-mediated genome editing systems successfully established in M. maripaludis . For knockout studies, markerless deletion strategies provide clean genetic backgrounds for phenotypic analysis without polar effects on neighboring genes. Site-directed mutagenesis can be accomplished using integrative plasmids containing homologous flanking regions . For fine-tuned expression studies, researchers can employ inducible promoter systems to control MMP1698 expression levels. Complementation studies using shuttle vectors allow for verification of phenotypes and structure-function analysis through expression of modified protein variants. When designing genetic constructs, researchers should consider codon usage optimization and appropriate selection markers for M. maripaludis. Integration of reporter genes such as fluorescent proteins can facilitate monitoring of expression patterns and localization studies, though care must be taken with fluorophore selection due to the anaerobic growth conditions required.
While comprehensive characterization of MMP1698's specific role remains incomplete, preliminary research indicates potential involvement in membrane-associated metabolic processes and stress adaptation. Based on expression pattern analysis during different growth phases and under various stress conditions, MMP1698 shows regulated expression that correlates with specific environmental challenges. Its transmembrane structure suggests possible roles in maintaining ion homeostasis, particularly under osmotic stress conditions, or in substrate/metabolite transport across the archaeal membrane. Comparative genomics approaches examining conservation across methanogen species indicate higher conservation in hydrogenotrophic methanogens, suggesting a potential role in hydrogen metabolism pathways. Research employing metabolomics analysis of MMP1698 knockout strains would be particularly valuable for identifying specific metabolic networks affected by the protein. Integration of transcriptomic and proteomic data from wild-type and mutant strains under varying growth conditions could further elucidate its functional significance in the broader context of archaeal physiology.
Successful cultivation of M. maripaludis presents several technical challenges requiring careful attention. A frequent issue is oxygen contamination, which severely inhibits growth due to the strict anaerobic nature of the organism. This can be addressed by using proper anaerobic techniques, including pre-reduced media, working in anaerobic chambers, and employing oxygen scavengers like Na₂S·9H₂O (0.5 mol L⁻¹) . Another common problem is insufficient gas substrate supply, which limits growth potential. Implementing optimized feeding schedules with H₂/CO₂ (4:1) mixture, typically twice daily for larger cultures, significantly improves biomass yield . Suboptimal agitation can lead to gas-liquid mass transfer limitations; researchers should consider a stepwise conservative agitation profile that gradually increases rpm based on culture density . Media precipitation issues can be minimized by adjusting pH carefully and ensuring proper mixing of components. Contamination by faster-growing organisms requires strict aseptic technique and regular microscopic examination. Finally, inefficient scale-up transitions often cause extended lag phases; this can be mitigated by transferring cultures during exponential growth phase rather than stationary phase when moving to larger volumes .
Expression and purification of functional MMP1698 present several technical challenges that researchers should anticipate and address. Membrane protein aggregation is a common issue that can be mitigated by employing mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin during extraction and purification. Protein misfolding in heterologous expression systems can be reduced by optimizing induction conditions, including lower temperatures (16-20°C) and reduced inducer concentrations. When facing low expression yields, consider archaeal-specific codon optimization or testing alternative expression hosts like Haloferax volcanii for certain applications. Proteolytic degradation during purification can be prevented by incorporating protease inhibitor cocktails and performing all steps at 4°C with minimal exposure to freeze-thaw cycles. For difficult-to-solubilize proteins, detergent screening panels can identify optimal extraction conditions. Maintaining protein stability throughout purification often requires the inclusion of glycerol (10-20%) and reducing agents in all buffers. Finally, verifying protein functionality through activity assays or binding studies is essential before proceeding with experimental applications, as purification conditions may affect native conformational states.
The potential applications of MMP1698 in synthetic biology and metabolic engineering of methanogens represent an exciting frontier for research. If MMP1698 is confirmed to participate in membrane transport or environmental sensing, it could be engineered as a modular component for creating synthetic metabolic pathways in M. maripaludis. Recent successful metabolic engineering of M. maripaludis for production of geraniol and polyhydroxybutyrate demonstrates the feasibility of such approaches . Researchers could potentially modify MMP1698 through directed evolution or rational design to create variants with enhanced substrate specificity or improved function under specific conditions. Engineering chimeric proteins by combining functional domains of MMP1698 with other membrane proteins might generate novel biological activities that enhance methanogen performance for biotechnological applications. The protein could also serve as a model for developing archaeal membrane protein expression tags or anchors, facilitating display of heterologous enzymes on cell surfaces. Understanding MMP1698's structure-function relationship would contribute to the expanding toolkit for archaeal synthetic biology, potentially enabling development of tunable gene expression systems responsive to specific environmental signals.
Comparative genomics approaches offer powerful insights into the evolutionary history and potential functions of MMP1698. Researchers should conduct comprehensive phylogenetic analyses across archaeal lineages to identify orthologs and trace evolutionary trajectories of this protein family. Multiple sequence alignments of UPF0290 family members can reveal conserved motifs and critical residues that have remained unchanged through evolutionary time, suggesting functional importance. Comparing gene neighborhood analysis across diverse methanogen species may uncover conserved genomic context, potentially identifying functionally related genes and pathways. Examining MMP1698 presence/absence patterns in methanogens with different metabolic capabilities (hydrogenotrophic, methylotrophic, acetoclastic) could link the protein to specific metabolic strategies. Analysis of selective pressure through calculation of Ka/Ks ratios would indicate whether the gene has undergone positive, negative, or neutral selection, providing clues about evolutionary constraints. Integration with structural prediction models can map conserved regions onto three-dimensional structures, highlighting potentially important functional domains. These approaches collectively would generate testable hypotheses about MMP1698's biological role and significance in archaeal biology.
A comprehensive experimental strategy combining multiple techniques would be required to definitively characterize MMP1698's biological function. Targeted gene deletion using CRISPR-Cas systems should be performed first to establish a knockout phenotype under various growth conditions and stressors. This should be complemented by transcriptomic analysis comparing wild-type and knockout strains to identify affected gene networks. Protein localization studies utilizing fluorescent protein fusions or immunofluorescence microscopy would confirm subcellular distribution. Protein-protein interaction mapping through techniques such as co-immunoprecipitation followed by mass spectrometry could identify binding partners, suggesting functional pathways. Metabolomic profiling comparing wild-type and knockout strains would reveal altered metabolite levels, potentially pointing to specific biochemical processes involving MMP1698. Structure determination through X-ray crystallography or cryo-EM would provide atomic-level insights into potential functional mechanisms. Site-directed mutagenesis of conserved residues followed by phenotypic analysis would establish structure-function relationships. Finally, heterologous expression in different hosts followed by functional complementation tests would verify the protein's autonomy or dependence on species-specific factors. This multi-faceted approach would generate a comprehensive understanding of MMP1698's biological significance.