Recombinant Methanococcus vannielii Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Role in Cobalamin Biosynthesis

CobD is integral to the anaerobic cobalamin biosynthesis pathway, which differs from the aerobic route by incorporating cobalt early in the process . Key functions include:

  • Amidation of Cobyrinic Acid: CobD converts cobyrinic acid into cobyric acid by amidating six of its seven carboxyl groups, leaving one free for subsequent aminopropanol attachment .

  • Cobalt Coordination: Facilitates cobalt insertion and stabilization within the corrin ring, a prerequisite for adenosylcobalamin formation .

This pathway is shared among anaerobic archaea and bacteria such as Salmonella typhimurium and Propionibacterium freudenreichii .

Production and Purification

Recombinant CobD is produced via heterologous expression in E. coli, followed by affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resins due to the His tag . Critical steps include:

  • Cloning: The cobD gene (locus tag: MEVAN_RS01220) is amplified from M. vannielii genomic DNA and ligated into expression vectors like pUC19 .

  • Expression: Induced using IPTG in E. coli cultures, yielding soluble protein .

  • Storage: Stable at -20°C or -80°C for long-term preservation; repeated freeze-thaw cycles are discouraged .

Applications and Research Utility

Recombinant CobD is primarily used to study:

  • Enzymatic Mechanisms: Kinetic assays to elucidate amidation and cobalt-chelation steps .

  • Pathway Engineering: Optimizing cobalamin production in industrial strains like Pseudomonas denitrificans .

  • Structural Biology: X-ray crystallography and NMR to resolve active-site architecture .

Challenges and Future Directions

Despite advancements, unresolved questions include:

  • Substrate Specificity: How CobD distinguishes between carboxyl groups during amidation .

  • Regulatory Interactions: Coordination with adjacent enzymes like CobO (adenosyltransferase) and CobQ (amidase) .

  • Biotechnological Optimization: Enhancing yield and stability in recombinant systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your preference during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
cobD; Mevan_0238; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Target Names
cobD
Target Protein Sequence
MINPIYLIIADLLDRYIGEPPEKLHPVVFIGNFVKFLEKVFPSTHSVEKLKDLVFGFITV FLTVFTVFLIFFTLELILNLISNYYIKLFSYSLILSFSIGHKSLLEFSKAPIKYIMSGDI KSARKSVQHIVSRDTSTLDEKHVISAAVESSSENITDSIIAPLIYAAIFGLSGAFIYRAV NTMDAMLGYKNEKYRYYGKTAAYLDDILNFIPSRIAGILLIISAPFYGGKIVPAIYGYLK EGFKTPSPNSGYTMAVIANSLSMELEKIGCYKLGKGEITVLKAVNSLKAVDYSVLLFLVI YMVLYFNLIY
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanococcus vannielii and why is it significant as a model organism?

Methanococcus vannielii is a strictly anaerobic, motile coccus belonging to the domain Archaea. It possesses a distinctive tuft of flagellae and lacks a typical bacterial cell wall structure. M. vannielii has gained significance as a model organism for studying methanogenesis, which is a uniquely archaeal metabolism . Unlike many other methanogens, M. vannielii grows normally in media of low ionic strength, making it relatively easier to culture under laboratory conditions. Its cell envelope lacks a peptidoglycan layer but features a regular array of surface subunits similar to the glycoprotein envelopes found in halobacteria . The organism has been instrumental in advancing our understanding of archaeal biology, including methane production pathways, coenzyme structures, and genome organization.

What is the function of CobD protein in M. vannielii?

The CobD protein in M. vannielii is classified as a probable cobalamin biosynthesis protein based on sequence homology and functional predictions. In cobalamin (vitamin B12) biosynthetic pathways, CobD typically functions as an L-threonine O-3-phosphate decarboxylase, catalyzing the conversion of L-threonine-O-3-phosphate to (R)-1-aminopropan-2-ol O-phosphate . This reaction represents a critical step in the assembly of the aminopropanol moiety that connects the lower nucleotide loop to the corrin ring in the cobalamin molecule. The full-length recombinant CobD protein from M. vannielii consists of 310 amino acids and has been successfully expressed in E. coli with an N-terminal His tag to facilitate purification and characterization studies .

What expression systems are most effective for producing recombinant M. vannielii CobD protein?

For the expression of recombinant M. vannielii CobD protein, E. coli-based systems have proven most effective and are widely used in research settings . The E. coli expression system offers several advantages, including rapid growth rates, well-established genetic manipulation techniques, and high protein yields. For optimal expression, the full-length coding sequence (positions 1-310 amino acids) of the cobD gene can be cloned into expression vectors featuring inducible promoters such as T7 or tac. The addition of an N-terminal His tag facilitates downstream purification while typically having minimal impact on protein function . When designing expression constructs, codon optimization may be necessary to account for the differences in codon usage between archaeal and bacterial systems. Temperature modulation (typically 18-25°C) during induction can help improve the solubility of the recombinant protein and reduce inclusion body formation.

What are the optimal conditions for purifying His-tagged M. vannielii CobD protein?

The purification of His-tagged M. vannielii CobD protein can be achieved through immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices. For optimal results, cells should be lysed under native conditions using either sonication or pressure-based disruption in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors. The inclusion of 10% glycerol and 1-5 mM β-mercaptoethanol in buffers can enhance protein stability. After binding to the Ni-NTA resin, washing steps with increasing imidazole concentrations (20-40 mM) help remove non-specifically bound proteins. Elution is typically performed with 250-300 mM imidazole, followed by immediate buffer exchange using dialysis or size exclusion chromatography to remove imidazole. For higher purity, additional chromatography steps such as ion exchange or hydrophobic interaction chromatography may be employed. Throughout the purification process, maintaining anaerobic conditions may be necessary, as proteins from strictly anaerobic organisms like M. vannielii can be sensitive to oxygen exposure.

How can researchers verify the proper folding and activity of purified recombinant CobD?

Verifying the proper folding and activity of purified recombinant CobD requires a multi-faceted approach. First, assess protein homogeneity through SDS-PAGE analysis, which should reveal a single band at approximately 34-36 kDa (the expected size for a 310-amino acid protein plus the His tag). Circular dichroism (CD) spectroscopy can provide insights into the secondary structure composition, with properly folded CobD likely exhibiting a mixture of α-helical and β-sheet elements. Thermal shift assays using fluorescent dyes like SYPRO Orange can determine protein stability and identify buffer conditions that optimize folding. For functional verification, enzymatic activity assays measuring the decarboxylation of L-threonine-O-3-phosphate to form (R)-1-aminopropan-2-ol O-phosphate can be performed. This reaction can be monitored through coupled enzyme assays or by directly quantifying substrate consumption and product formation using HPLC or LC-MS. Additionally, binding studies with potential substrates or cofactors using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can provide complementary evidence of proper protein folding and function.

What are the established enzymatic assays for measuring CobD activity?

The enzymatic activity of CobD can be measured through several established assays that quantify either substrate consumption or product formation. The primary assay monitors the decarboxylation of L-threonine-O-3-phosphate to produce (R)-1-aminopropan-2-ol O-phosphate. This reaction can be followed by measuring the release of CO2 using radioactive substrates (14C-labeled L-threonine-O-3-phosphate) and scintillation counting. Alternatively, a coupled enzymatic assay can be employed where the decarboxylation reaction is linked to NAD+/NADH conversion through auxiliary enzymes, allowing spectrophotometric monitoring at 340 nm. For more precise quantification, HPLC or LC-MS methods can directly measure the decrease in substrate concentration and corresponding increase in product. The optimal assay conditions typically include a buffer pH range of 7.5-8.5, temperature of 37-45°C, and potential requirement for divalent metal ions (Mg2+ or Mn2+) as cofactors. When performing these assays, it's critical to establish proper controls, including heat-inactivated enzyme and reactions without substrate, to account for background signals and non-enzymatic reactions.

What cofactors are necessary for optimal CobD enzymatic activity?

For optimal enzymatic activity, CobD likely requires several cofactors and specific environmental conditions. The primary cofactor is pyridoxal 5′-phosphate (PLP), which serves as an essential prosthetic group for the decarboxylation reaction. PLP forms a Schiff base with a conserved lysine residue in the active site, creating an electron sink that facilitates the decarboxylation mechanism. Divalent metal ions, particularly Mg2+ or Mn2+, may also be required as cofactors, potentially stabilizing the phosphate group of the substrate during catalysis. Given M. vannielii's anaerobic nature, maintaining reducing conditions during enzyme assays is crucial, typically achieved by including reducing agents such as dithiothreitol (DTT) or β-mercaptoethanol in reaction buffers at concentrations of 1-5 mM. Enzyme activity assays should be conducted at pH values between 7.5-8.5, with optimal activity often observed around pH 8.0. Temperature optimization is also important, with enzymatic activity typically peaking between 37-45°C, reflecting M. vannielii's mesophilic growth preferences.

How can site-directed mutagenesis of CobD elucidate the catalytic mechanism?

Site-directed mutagenesis offers a powerful approach to elucidate the catalytic mechanism of M. vannielii CobD by systematically modifying key amino acid residues and evaluating the resulting effects on enzyme activity. Based on homology with other PLP-dependent decarboxylases, several targets for mutagenesis can be identified: (1) The conserved lysine residue that forms a Schiff base with PLP can be mutated to alanine or arginine to confirm its essential role in catalysis; (2) Residues that interact with the phosphate group of L-threonine-O-3-phosphate can be mutated to assess substrate binding specificity; (3) Amino acids involved in PLP binding pocket formation can be altered to understand cofactor interactions. Each mutant should undergo full kinetic characterization, determining parameters such as kcat, KM, and catalytic efficiency (kcat/KM) under standardized conditions. Structural studies using X-ray crystallography or cryo-EM can complement the functional data by visualizing structural changes induced by mutations. Additionally, isotope effects (using deuterated substrates) can provide insights into rate-limiting steps in the reaction mechanism. This comprehensive mutagenesis approach can ultimately lead to a detailed model of the enzyme's catalytic mechanism and potentially guide rational enzyme engineering efforts.

How can CobD be used to study evolutionary relationships among methanogenic archaea?

CobD serves as an excellent molecular marker for studying evolutionary relationships among methanogenic archaea due to its involvement in the essential process of cobalamin biosynthesis. Comparative genomic analyses of cobD sequences from diverse methanogens can reveal patterns of vertical inheritance, horizontal gene transfer, and functional divergence. To utilize CobD for phylogenetic studies, researchers should first collect and align cobD gene sequences from a broad range of methanogenic species, including representatives from different orders such as Methanococcales, Methanobacteriales, and Methanosarcinales. Multiple sequence alignment tools like MUSCLE or MAFFT can identify conserved motifs and variable regions. Phylogenetic tree construction using maximum likelihood or Bayesian methods can then reveal evolutionary relationships, potentially identifying instances where cobD evolution deviates from 16S rRNA phylogeny—suggesting horizontal gene transfer events. Syntenic analysis examining the genomic context of cobD can provide additional insights, as demonstrated by the conserved organization of methane gene clusters observed in M. vannielii and other methanogens . By integrating these approaches, researchers can use CobD to explore broader questions about archaeal evolution, including adaptation to different environmental niches and the diversification of cobalamin-dependent metabolic pathways.

What approaches can be used to study CobD interactions with other proteins in the cobalamin biosynthesis pathway?

Understanding CobD's interactions with other proteins in the cobalamin biosynthesis pathway requires integrated approaches spanning molecular, biochemical, and computational techniques. In vivo crosslinking with formaldehyde or photo-reactive amino acid analogs can capture transient protein-protein interactions under physiological conditions. The resulting complexes can be isolated through tandem affinity purification (TAP) using the His-tagged CobD as bait, followed by mass spectrometry identification of interaction partners. Complementary in vitro techniques include surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC), which provide quantitative binding parameters (KD, stoichiometry) for purified components. Yeast two-hybrid or bacterial two-hybrid systems can be adapted to screen for interactions, though modifications may be necessary given M. vannielii's archaeal origin. For structural characterization of complexes, cryo-electron microscopy or X-ray crystallography of co-purified proteins can reveal interaction interfaces at atomic resolution. Computational approaches like protein-protein docking and molecular dynamics simulations can predict interaction surfaces and guide experimental design. Functional validation through activity assays of reconstituted protein complexes is essential, potentially revealing cooperative kinetics or substrate channeling between sequential enzymes in the pathway. These combined approaches can ultimately elucidate how CobD coordinates with other enzymes in the cobalamin biosynthesis pathway within the archaeal cellular context.

What strategies can overcome challenges in expressing soluble CobD protein?

When facing challenges in expressing soluble M. vannielii CobD protein, researchers can implement several strategic approaches. First, optimize expression temperature—lowering induction temperature to 16-18°C and extending expression time to 16-24 hours often improves solubility by slowing protein synthesis and allowing proper folding. Second, modify growth media by supplementing with osmolytes like glycerol (5-10%), sorbitol (0.5-1 M), or betaine (1-2.5 mM) to stabilize folding intermediates. Third, co-express molecular chaperones such as GroEL/ES, DnaK/J, or trigger factor to assist proper folding of archaeal proteins in the bacterial host. Fourth, consider fusion protein strategies using solubility enhancers like maltose-binding protein (MBP), NusA, or SUMO at the N-terminus (while maintaining the C-terminal His-tag for purification). Fifth, explore alternative E. coli expression strains optimized for proteins with rare codons (like Rosetta) or improved disulfide bond formation (like SHuffle). For persistent solubility issues, in vitro refolding from inclusion bodies can be attempted using step-wise dialysis against decreasing concentrations of denaturants. Cell-free expression systems represent another alternative, as they can incorporate archaeal-specific components that might facilitate proper folding. Each approach should be systematically tested and evaluated by analyzing protein expression levels and solubility through Western blotting and activity assays.

How can researchers distinguish between true enzymatic activity and artifact signals in CobD assays?

Distinguishing true enzymatic activity from artifacts in CobD assays requires rigorous experimental design and appropriate controls. First, implement comprehensive negative controls: (1) Reactions without enzyme; (2) Heat-denatured enzyme controls; (3) Buffer-only controls; and (4) Reactions with purified non-relevant proteins of similar size/tag. Second, confirm enzyme specificity through substrate analogs—structural analogs of L-threonine-O-3-phosphate should show different kinetic parameters or no activity. Third, validate activity through multiple independent assay methods—concordant results from radiometric, spectrophotometric, and chromatographic assays strengthen confidence in the observed activity. Fourth, perform enzyme concentration dependency tests—true enzymatic reactions should show proportional activity to enzyme concentration within the linear range. Fifth, apply specific inhibitors of PLP-dependent enzymes, such as hydroxylamine or aminooxyacetic acid, which should abolish CobD activity if it's a genuine PLP-dependent reaction. Sixth, analyze reaction products through multiple analytical techniques (HPLC, MS, NMR) to confirm their chemical identity matches the expected (R)-1-aminopropan-2-ol O-phosphate. Seventh, conduct time-course experiments to demonstrate progressive substrate consumption and product formation patterns consistent with enzymatic catalysis. By systematically implementing these approaches, researchers can confidently differentiate authentic CobD activity from non-enzymatic reactions or instrument artifacts.

What are the common contradictions in the literature regarding M. vannielii CobD function, and how can researchers address them?

The literature on M. vannielii CobD function contains several contradictions that researchers should address through systematic investigation. One persistent contradiction concerns the metal ion dependency of CobD activity—some studies suggest absolute requirements for divalent cations like Mg2+ or Mn2+, while others report activity in their absence. To resolve this, researchers should conduct metal dependency studies using highly purified enzyme preparations with careful removal of metal ions through chelating agents (EDTA treatment followed by extensive dialysis), then systematically test activity restoration with various metal ions at different concentrations. Another contradiction involves the reported substrate specificity—while primarily characterized as L-threonine-O-3-phosphate decarboxylase, some reports suggest broader substrate tolerance. This can be addressed through comparative kinetic analysis of structurally related compounds, determining kcat/KM values for each potential substrate. Discrepancies in the reported pH optima (ranging from pH 7.0 to 8.5) can be resolved by establishing complete pH-activity profiles under standardized buffer conditions with constant ionic strength. Contradictory reports about CobD's position in the cobalamin biosynthetic pathway can be clarified through metabolite profiling of pathway intermediates in knockout/complementation studies. When designing experiments to address these contradictions, researchers should carefully document experimental conditions, enzyme preparation methods, and analysis techniques to enable meaningful cross-study comparisons and reconciliation of divergent findings.

How does cobalamin biosynthesis connect to the methanogenesis pathways in M. vannielii?

Cobalamin biosynthesis and methanogenesis pathways in M. vannielii are interconnected through multiple metabolic and regulatory mechanisms. Cobalamin (vitamin B12) serves as an essential cofactor for methyltransferases in the methanogenic pathway, particularly for the methyl-H4MPT:CoM-methyltransferase (Mtr) enzyme complex . This enzyme catalyzes the transfer of the methyl group from methyl-tetrahydromethanopterin (methyl-H4MPT) to coenzyme M (HS-CoM), representing a critical step in the methanogenesis pathway . The genomic organization in M. vannielii reveals that the mtr operon, encoding the methyltransferase components, is positioned adjacent to the mcr operon, which encodes the methyl-CoM reductase—the enzyme catalyzing the final step in methane production . This genomic arrangement suggests coordinated regulation of cobalamin-dependent and terminal methanogenesis steps. The CobD protein specifically contributes to the aminopropanol biosynthesis branch of the cobalamin pathway, ultimately affecting the availability of functional cobalamin cofactors for methyl transfer reactions. Research aiming to understand this connection should focus on metabolic flux analysis using isotope-labeled precursors to trace carbon flow between these pathways, and gene expression studies to identify co-regulated clusters under varying growth conditions.

What genetic tools are available for manipulating the cobD gene in M. vannielii?

The genetic manipulation of the cobD gene in M. vannielii can leverage several tools developed for methanogenic archaea, particularly those established for the Methanococcus species. Natural transformation systems have been demonstrated in related Methanococcus species, with efficiencies of approximately 8 transformants per μg of DNA reported for Methanococcus voltae . More efficient transformation can be achieved through protoplast generation, which has increased transformation efficiencies by 102-105 fold in Methanococcus maripaludis . These approaches can be adapted for M. vannielii with appropriate modifications. For targeted manipulation of the cobD gene, researchers can employ marker-based gene deletion systems utilizing puromycin resistance cassettes from Streptomyces alboniger as selectable markers . More advanced markerless mutagenesis protocols have been established for related methanogens, enabling precise genetic modifications without permanent marker integration . Recently developed CRISPR-Cas12a and CRISPR-Cas9 systems reported for methanogens provide powerful tools for precise genome editing and can be adapted for cobD manipulation . When designing genetic constructs, researchers should account for M. vannielii's codon usage preferences and incorporate appropriate archaeal promoters and termination signals to ensure proper gene expression in the native context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.