Recombinant Methanococcus vannielii Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanococcus vannielii Protein CrcB Homolog

Recombinant Methanococcus vannielii Protein CrcB homolog, commonly referred to as crcB, is a protein derived from the archaeon Methanococcus vannielii. This protein is significant due to its proposed role in fluoride ion transport, which is critical for cellular homeostasis and toxicity reduction in environments with high fluoride concentrations. The crcB gene encodes a transmembrane protein that functions as a fluoride exporter, thereby mitigating fluoride toxicity within the cell.

Protein Characteristics

  • Gene Name: crcB

  • UniProt ID: A6UPS4

  • Protein Length: 122 amino acids

  • Molecular Weight: Approximately 13,581 Da

  • Expression System: Typically expressed in Escherichia coli as a His-tagged recombinant protein.

  • Purity: Greater than 90% as determined by SDS-PAGE.

Table 1: Basic Characteristics of Recombinant Methanococcus vannielii Protein CrcB

FeatureDetails
SpeciesMethanococcus vannielii
SourceEscherichia coli
TagHis
FormLyophilized powder
Storage Conditions-20°C or -80°C
ReconstitutionDeionized sterile water

Functional Role of CrcB

The primary function of the CrcB protein is hypothesized to involve:

  • Fluoride Ion Transport: CrcB is believed to act as a fluoride exporter, which is essential for maintaining low intracellular fluoride levels. This function is particularly important in environments where fluoride concentrations are elevated, potentially leading to toxicity.

  • Gene Regulation: The expression of crcB is regulated by a fluoride riboswitch mechanism, which allows the organism to adapt to varying environmental fluoride levels by modulating gene expression related to ion transport and other cellular functions.

Research Findings

Research has demonstrated that the CrcB protein exhibits homology with similar proteins found in other archaea and eukaryotic organisms. Comparative studies indicate that the sequence of Methanococcus vannielii CrcB shares significant similarities with fluoride transporters across different species.

Table 2: Comparative Sequence Homology of CrcB

OrganismSimilarity (%)Notes
Methanococcus jannaschii85%Closely related homolog
Halobacterium marismortui78%Significant functional overlap
Eukaryotic Fluoride Transporters65%Conservation across kingdoms

Applications and Usage

Recombinant Methanococcus vannielii Protein CrcB homolog has several applications in research and biotechnology:

  • Biochemical Studies: Understanding the transport mechanisms of fluoride ions can provide insights into cellular responses to environmental stressors.

  • Potential Therapeutic Targets: Given its role in mitigating fluoride toxicity, CrcB may be explored as a target for developing strategies against fluoride-related health issues.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; Mevan_0590; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Target Names
crcB
Target Protein Sequence
MKEYFLIGIGGFTGAVLRYVISGIIPVKFGIPTGTLMVNLIGSFIVGFLMYSSLFTGISY EYRLFIITGFCGALTTFSTFSYESFSLLEQHYFIKSGINILTNVTGCISMIYFGRMVSSS FW
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the fluoride riboswitch regulate CrcB expression in Methanococcus vannielii?

The CrcB protein in M. vannielii is regulated by a fluoride-responsive riboswitch. Riboswitches are structured RNA elements that can bind specific molecules and subsequently alter gene expression. In the case of the fluoride riboswitch, binding of fluoride molecules causes a conformational change in the RNA structure, which typically upregulates the expression of downstream genes including crcB .

The mechanism involves fluoride molecules binding to the riboswitch, which changes sites of spontaneous cleavage in a manner that increases translation and expression of downstream genes. This regulatory mechanism allows the organism to respond to environmental fluoride levels by increasing expression of genes that mitigate fluoride toxicity, including crcB. This represents an elegant adaptive response that helps archaeal organisms like M. vannielii survive in environments with fluctuating fluoride concentrations .

What is the proposed biological function of CrcB protein in Methanococcus vannielii?

The CrcB protein in M. vannielii is hypothesized to function primarily as a fluoride exporter. Fluoride ions can be toxic to cells, and organisms have evolved mechanisms to mitigate this toxicity. The CrcB protein is believed to facilitate the export of fluoride ions from the cell, thereby reducing intracellular fluoride concentrations and preventing toxic effects .

The association of the crcB gene with the fluoride riboswitch further supports this function. The riboswitch mechanism increases expression of the crcB gene in response to higher concentrations of fluoride, which would be beneficial for the organism in avoiding fluoride toxicity. This represents a sophisticated regulatory system where the expression of the detoxification machinery (CrcB) is directly controlled by the presence of the toxic substance (fluoride) .

How does recombinant M. vannielii CrcB compare structurally and functionally to CrcB homologs in other archaea or bacteria?

Comparative analysis of CrcB proteins across different domains of life reveals both conservation and specialization. While the M. vannielii CrcB functions as a putative fluoride exporter, similar to homologs in other organisms, there may be archaeal-specific adaptations that optimize its function in the unique cellular environment of archaea.

What methodological challenges exist in studying the transmembrane topology of recombinant CrcB protein?

Studying transmembrane proteins like CrcB presents several significant methodological challenges:

  • Expression and purification difficulties: Membrane proteins often express poorly in heterologous systems and may form inclusion bodies. While the recombinant M. vannielii CrcB can be expressed in E. coli with an N-terminal His-tag , optimizing expression conditions to maintain proper folding is critical.

  • Solubilization issues: Extracting membrane proteins while maintaining their native structure requires careful selection of detergents. For CrcB, typical approaches would involve screening different detergents and lipid compositions to maintain functional integrity during purification.

  • Structural analysis limitations: Traditional structural biology techniques like X-ray crystallography are challenging with membrane proteins. Newer approaches like cryo-electron microscopy may offer alternatives but require specialized equipment and expertise.

  • Functional reconstitution: To study transport activity, CrcB would need to be reconstituted into liposomes or other membrane mimetics, which introduces additional technical complexities.

For researchers addressing these challenges, a recombineering-based approach might facilitate the creation of modified constructs with reporter tags or fusion proteins that could aid in topology mapping while maintaining function .

How might post-translational modifications affect the function of the CrcB protein in the archaeal cellular environment?

Post-translational modifications (PTMs) in archaeal proteins represent an understudied area that could significantly impact CrcB function. Several considerations are important:

  • Archaeal-specific PTMs: Archaea may employ unique post-translational modifications different from those in bacteria or eukaryotes. These could include specialized methylation, acetylation, or archaeal-specific lipid modifications.

  • Impact on transport activity: Modifications might directly affect fluoride binding sites or alter the conformational dynamics of the transport cycle.

  • Regulatory role: PTMs could serve as an additional regulatory layer beyond the riboswitch mechanism, potentially allowing for more rapid response to changing fluoride concentrations.

  • Environmental adaptation: Given the extreme environments many archaea inhabit, including M. vannielii, PTMs might contribute to protein stability under various stress conditions.

Research methodologies to investigate these aspects would include mass spectrometry approaches to identify PTMs on the native protein compared to recombinant versions, and mutational studies to assess the functional impact of modified residues.

What are the optimal expression and purification strategies for obtaining functionally active recombinant M. vannielii CrcB protein?

Obtaining functionally active recombinant CrcB protein requires careful optimization of expression and purification conditions:

ParameterRecommended ApproachRationale
Expression SystemE. coli with specialized membrane protein vectorsProvides balance between yield and proper folding
InductionLow IPTG concentration (0.1-0.5 mM), lower temperature (18-25°C)Reduces inclusion body formation
SolubilizationScreen detergents (DDM, LDAO, etc.)Different detergents vary in maintaining protein structure
PurificationIMAC via His-tag, followed by size exclusion chromatographyTwo-step purification improves purity
StorageTris/PBS-based buffer with 6% trehalose, pH 8.0 Maintains stability during storage
ReconstitutionReconstitute to 0.1-1.0 mg/mL with 5-50% glycerol Prevents aggregation and maintains function

The recombinant protein is typically provided as a lyophilized powder, and proper reconstitution is critical for maintaining functionality. After centrifuging the vial, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with added glycerol (5-50% final concentration) to maintain stability during storage at -20°C/-80°C .

How can researchers effectively design functional assays to measure fluoride transport activity of recombinant CrcB protein?

Designing functional assays for CrcB requires approaches that can accurately measure fluoride transport:

  • Liposome-based fluoride transport assays: Reconstituting purified CrcB into liposomes loaded with fluoride-sensitive dyes allows for real-time monitoring of transport activity. Dyes such as SBFI (sodium-binding benzofuran isophthalate) modified for fluoride sensitivity can be used.

  • Electrode-based measurements: Fluoride-selective electrodes can measure changes in fluoride concentration on either side of a membrane containing reconstituted CrcB.

  • Cellular assays using fluoride-sensitive reporter systems: Genetically encoded fluoride sensors expressed in cells containing recombinant CrcB can provide functional data in a more native-like environment.

  • Growth complementation assays: Expression of M. vannielii CrcB in fluoride-sensitive bacterial strains lacking endogenous fluoride exporters can demonstrate functional activity through rescue of growth inhibition.

For each assay, appropriate controls are essential, including:

  • Liposomes/cells without CrcB protein

  • CrcB with site-directed mutations in predicted transport-critical residues

  • Inhibitor controls (if known inhibitors exist)

What recombineering strategies are most effective for generating modified versions of the crcB gene for structure-function studies?

Recombineering offers powerful approaches for precise genetic modifications of the crcB gene:

  • Oligonucleotide-directed mutagenesis: For creating point mutations, short (~70 bp) synthetic oligonucleotides containing the desired mutation can be used with λ Red recombination proteins to precisely alter specific nucleotides within the crcB sequence .

  • PCR-generated targeting cassettes: For larger modifications like deletions, insertions, or domain replacements, PCR products with homology arms flanking the target region can be generated. The homology arms should be 50 bp or longer for optimal efficiency .

  • Two-step selection/counter-selection strategy: For scarless modifications, a selection marker can be inserted and then precisely removed, leaving only the desired mutation without additional sequence changes.

The recombineering workflow involves:

  • Generating the appropriate linear targeting substrate DNA

  • Providing the λ Red recombination genes

  • Inducing the λ recombination genes

  • Preparing electrocompetent cells and electroporating the linear targeting substrate DNA

  • Outgrowth following electroporation

  • Identifying and confirming the recombinant clones

High-fidelity Taq DNA polymerase with proofreading ability (such as Invitrogen High Fidelity Platinum Taq or Roche Expand High Fidelity) should be used for generating dsDNA PCR products for recombineering substrates .

How might structural data from M. vannielii CrcB inform the development of antimicrobial strategies targeting CrcB in pathogenic archaea?

Structural insights from M. vannielii CrcB could inform novel antimicrobial strategies in several ways:

  • Identification of critical transport residues: Detailed structural analysis may reveal residues essential for fluoride binding and transport. These could represent conserved targets for inhibitor design across archaeal pathogens.

  • Species-specific structural features: Comparing CrcB structures across species could identify archaeal-specific features that could be selectively targeted, minimizing effects on beneficial microorganisms.

  • Allosteric inhibition sites: Beyond the active transport site, structural data might reveal allosteric regulation sites that could be targeted to lock the protein in inactive conformations.

  • Structure-based drug design: Computational approaches using solved structures could facilitate virtual screening of compound libraries to identify potential CrcB inhibitors.

The development of such targeted approaches would be particularly valuable for treating infections by antibiotic-resistant archaeal pathogens where conventional antibiotics may be ineffective.

What insights can comparative genomics provide about the evolution of the crcB gene and fluoride resistance in Methanococcus species?

Comparative genomics approaches can provide valuable insights into the evolution of fluoride resistance mechanisms:

  • Phylogenetic distribution: Analysis of crcB gene distribution across archaeal species can reveal patterns of conservation, horizontal gene transfer events, and lineage-specific adaptations. The presence of crcB genes in diverse archaeal species suggests the ancient origin of this detoxification mechanism .

  • Coevolution with riboswitches: Examining the relationship between crcB genes and fluoride riboswitches across species can demonstrate how these regulatory elements have co-evolved. The fluoride riboswitch has been documented in archaea, where it's associated with genes encoding proteins mostly related to ion transport, including crcB .

  • Genetic context analysis: Examining genes adjacent to crcB can reveal functionally related genes that may participate in broader fluoride response networks. This context can vary between species, providing insights into different adaptive strategies.

  • Selection pressure analysis: Calculating the ratio of nonsynonymous to synonymous substitutions (dN/dS) across crcB sequences can identify regions under positive selection, potentially highlighting functionally important adaptations.

These comparative approaches can help reconstruct the evolutionary history of fluoride resistance in Methanococcus and related species, illuminating how these archaea have adapted to environments with varying fluoride levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.