Recombinant Methanococcus vannielii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Methanococcus vannielii Tetrahydromethanopterin S-methyltransferase subunit E (MtrE) is a critical enzyme in methanogenesis, the metabolic pathway responsible for methane production in archaea. MtrE is a subunit of the tetrahydromethanopterin S-methyltransferase (Mtr) complex, which catalyzes the methyl transfer from tetrahydromethanopterin (H4_4MPT) to coenzyme M, a key step in energy conservation during methanogenesis . Recombinant production enables biochemical and structural studies of this archaeal enzyme.

Gene and Protein Features

  • Gene Name: mtrE (MEVAN_RS04460 in M. vannielii) .

  • Operon Context: Part of the mtrEDCBAFGH operon, positioned downstream of the methyl-coenzyme M reductase (mcr) operon .

  • Protein Size: Recombinant MtrE is expressed as a partial or full-length protein, with purity ≥85% (SDS-PAGE) .

Table 2: Recombinant MtrE Variants

Construct TypeHost SystemPurityApplication
Full-length MtrEE. coli≥85%Functional assays
Partial MtrE (N-terminal)Baculovirus≥85%Structural studies

Research Findings

  • Gene Conservation: mtrE is conserved across methanogens, with high sequence similarity (>60%) between M. vannielii and Methanothermobacter species .

  • Operon Dynamics: In M. vannielii, mtrE is co-transcribed with mcr genes, suggesting coordinated regulation of methanogenesis .

  • Structural Insights: While MtrE’s structure remains uncharacterized, its homologs in M. maripaludis and M. jannaschii suggest a role in membrane anchoring .

Applications in Biotechnology

  • Enzyme Engineering: Used to study methyltransferase mechanisms for biofuel production .

  • Antibody Development: Recombinant MtrE serves as an antigen for generating antibodies against methanogen enzymes .

Key Challenges and Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography is needed to elucidate MtrE’s role in the Mtr complex .

  • Heterologous Expression: Optimizing full-length soluble MtrE remains challenging due to membrane association .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate them in your order notes, and we will prepare it accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimations, we recommend consulting your local distributors.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. To preserve product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please communicate it to us, and we will prioritize its development.
Synonyms
mtrE; Mevan_0873; Tetrahydromethanopterin S-methyltransferase subunit E; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Target Names
mtrE
Target Protein Sequence
MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGSVAWALINAGLNAVLALIIGSGVAAIVHGAYSVSAFLGRTVGQSQKF GQPVYMDVLTSHIGPIVGHGFIAVFTMVLAAYLAVTALGNPFPLPLVALIFGITVGAIGS STGDVHYGAEREYQKYAFGGGIPVANQGDIDIYAEYGIRNGLDSSYFCSRLGGPLTGLCF GLIIFLDGWRSIVGNIIGGDLVTKTSIALVVGLLVVVAAMILNRKIEVFARNKYGPYRN
Uniprot No.

Target Background

Function
This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process represents an energy-conserving, sodium-ion translocating step.
Database Links
Protein Families
MtrE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanococcus vannielii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)?

Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) is one component of the multi-subunit enzyme complex (MTR) involved in methanogenesis in Methanococcus vannielii. This protein has EC number 2.1.1.86 and is alternatively known as N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E. The gene is designated as mtrE with the ordered locus name Mevan_0873. The full-length protein has an expression region of 1-299 amino acids .

The protein is part of the mtrEDCBAFGH operon, which encodes all the MTR subunits necessary for the methyltransferase activity essential to methanogenic pathways. Interestingly, in many methanogens, this operon is positioned immediately downstream from the mcrBDCGA operon that encodes methyl-CoM reductase I (MRI), which catalyzes the final step in methanogenesis .

What role does mtrE play in methanogenesis?

The mtrE protein is a subunit of the Tetrahydromethanopterin S-methyltransferase (MTR) complex, which catalyzes a critical step in the methanogenesis pathway. Specifically, this enzyme catalyzes the transfer of a methyl group from N5-methyltetrahydromethanopterin to coenzyme M, forming methyl-CoM, an intermediate in methane production.

Most MTR subunits, including mtrE, have sequences consistent with membrane-located proteins, suggesting they are integrated into the cell membrane. While the specific function of mtrE within the complex is not fully characterized in the provided search results, the conservation of its sequence across multiple methanogen species indicates its essential role in the MTR complex functionality .

What are the optimal storage conditions for recombinant M. vannielii mtrE protein?

For recombinant M. vannielii mtrE protein, the optimal storage conditions are:

  • Short-term storage: Store at -20°C

  • Extended storage: Store at -20°C or -80°C

  • Working aliquots: Store at 4°C for up to one week

The protein is typically stored in a Tris-based buffer with 50% glycerol, which has been optimized for this particular protein's stability. Repeated freezing and thawing is not recommended as it may lead to protein degradation and loss of activity .

How can researchers effectively express and purify recombinant M. vannielii mtrE?

Based on methodologies used for similar methanogen proteins, researchers can express and purify recombinant M. vannielii mtrE using the following approach:

  • Expression System Selection: Heterologous expression in E. coli has been successfully used for other M. vannielii proteins, as evidenced by the selenium-binding protein (SeBP) study where the DNA corresponding to the gene was isolated from M. vannielii and heterologously expressed in E. coli .

  • Purification Strategy: For membrane-associated proteins like mtrE, purification typically requires:

    • Cell lysis under appropriate conditions

    • Membrane fraction isolation

    • Solubilization with suitable detergents

    • Chromatographic separation methods such as affinity chromatography if a tag is included in the recombinant protein

  • Activity Verification: Functional assays to confirm the activity of the purified protein, possibly through its interaction with other MTR complex subunits.

For specific methodologies, researchers can reference techniques used for similar methanogen proteins, adapting protocols as needed for this particular membrane-associated protein.

How does the mtrE subunit interact with other components of the MTR complex?

The MTR complex in M. vannielii contains multiple subunits encoded by the mtrEDCBAFGH operon. While specific interaction data for M. vannielii is limited in the provided search results, insights can be drawn from related methanogens:

In M. thermoautotrophicum and M. jannaschii, the MTR complex contains subunits with sizes ranging from 9 to 34 kDa. Of these subunits, MTRA is known to bind the corrinoid prosthetic group, which is essential for methyl transfer reactions. The other subunits, including mtrE, likely work in concert to form a functional membrane-associated complex .

The adjacent positioning of the mcr and mtr operons in multiple methanogen genomes suggests a functional relationship between these two enzyme complexes in the methanogenesis pathway. In M. thermoautotrophicum, some transcripts initiated at the mcr promoter extend through the mtr operon, resulting in ~10-kb transcripts that encode both MRI and MTR enzymes .

How does the function of mtrE in M. vannielii compare to homologous proteins in other methanogenic archaea?

The conservation of mtrE sequences across different methanogenic archaea suggests a similar function across species. The mtrEDCBAFGH operon organization is identical in M. thermoautotrophicum and M. jannaschii, and mtrE sequences have also been identified downstream of mcr operons in M. fervidus, M. kandleri, and M. vannielii .

The high sequence identity (~60%) of MTR subunits between M. thermoautotrophicum and M. jannaschii indicates functional conservation. Particularly noteworthy is the perfect conservation of the 24-amino acid sequence (AEDLESDVGSQSNPNSQVQLAPQM) encoded by codons 23-47 of mtrE in both methanogens, suggesting this region is crucial for protein function .

The adjacent positioning of the mcr and mtr operons appears to be a conserved feature across multiple methanogens, indicating a functional relationship between methyl-CoM reductase and tetrahydromethanopterin S-methyltransferase in the methanogenesis pathway.

What challenges are commonly encountered when working with recombinant M. vannielii mtrE, and how can they be addressed?

Several challenges may arise when working with recombinant M. vannielii mtrE:

  • Protein Solubility: As a membrane-associated protein, mtrE may have solubility issues during expression and purification.

    • Solution: Use appropriate detergents for solubilization and consider fusion tags that enhance solubility.

  • Maintaining Protein Stability: Membrane proteins can be unstable when removed from their native lipid environment.

    • Solution: Include glycerol (typically 50%) in storage buffers and optimize buffer composition to maintain protein stability .

  • Functional Assessment: Determining the activity of a single subunit separated from its complex can be challenging.

    • Solution: Consider co-expression with interacting partners or reconstitution experiments with other purified subunits of the MTR complex.

  • Expression in Heterologous Systems: E. coli may lack necessary post-translational modifications or folding machinery.

    • Solution: Consider alternative expression systems or co-expression with chaperones to aid proper folding.

What techniques are most effective for studying mtrE's role within the MTR complex?

Several techniques can be employed to study mtrE's role within the MTR complex:

  • Co-immunoprecipitation: To identify protein-protein interactions between mtrE and other MTR subunits.

  • Site-directed Mutagenesis: Targeting the highly conserved regions, particularly the AEDLESDVGSQSNPNSQVQLAPQM sequence, to assess their functional importance .

  • Crosslinking Studies: To capture transient interactions between subunits in the native complex.

  • Reconstitution Experiments: Using purified recombinant subunits to rebuild the complex in vitro and assess functionality.

  • Structural Biology Approaches: X-ray crystallography or cryo-electron microscopy of the purified complex or individual subunits to determine structural relationships.

  • Comparative Genomics: Analyzing the conservation and co-evolution of mtr subunits across different methanogenic species to infer functional relationships .

How can understanding M. vannielii mtrE contribute to broader research on methanogenesis and bioenergy applications?

Research on M. vannielii mtrE has several broader implications:

  • Fundamental Understanding of Methanogenesis: The MTR complex catalyzes a critical step in the methanogenic pathway. Detailed characterization of mtrE and its interactions within this complex enhances our understanding of the biochemical processes involved in biological methane production .

  • Climate Science Applications: Methanogens significantly contribute to global methane emissions. Understanding the enzymology of methanogenesis, including the role of mtrE, could inform strategies to mitigate methane emissions from natural and anthropogenic sources.

  • Bioenergy Research: Methanogens are used in biogas production. Insights into the MTR complex could potentially lead to engineered improvements in methanogenic archaea for enhanced bioenergy applications.

  • Evolutionary Studies: The conservation of mtrE across methanogenic archaea provides insights into the evolution of this ancient metabolic pathway and the organisms that utilize it .

What are the current limitations in our understanding of mtrE function, and what research approaches might address these gaps?

Current limitations and potential research approaches include:

  • Structural Information: Limited structural data exists for the MTR complex and its subunits.

    • Research Approach: Structural biology studies using X-ray crystallography, cryo-EM, or NMR spectroscopy of the purified mtrE protein or the entire MTR complex.

  • Precise Functional Role: The exact function of mtrE within the MTR complex remains unclear.

    • Research Approach: Biochemical assays with reconstituted complexes using wild-type and mutant versions of mtrE to determine its specific contribution to enzyme activity.

  • Regulatory Mechanisms: How expression and activity of mtrE are regulated in response to environmental conditions.

    • Research Approach: Transcriptomic and proteomic studies under varying growth conditions, similar to the hydrogen-dependent regulation studies performed with other methane genes .

  • Interaction Network: Comprehensive understanding of mtrE's interactions with other cellular components beyond the MTR complex.

    • Research Approach: Interactome studies using techniques like BioID or proximity labeling to identify proteins that associate with mtrE in vivo.

How does mtrE compare with other membrane-associated proteins involved in methanogenesis?

A comparative analysis of mtrE with other membrane-associated methanogenesis proteins reveals:

ProteinFunctionComplexMembrane AssociationConservation Across Methanogens
mtrEComponent of MTR complexTetrahydromethanopterin S-methyltransferaseLikely transmembrane proteinHigh; conserved sequence elements across species
McrAAlpha subunit of MCR complexMethyl-coenzyme M reductaseAssociated with membraneHigh; present in all methanogens
FpoNNADH dehydrogenase-like complexF420H2:methanophenazine oxidoreductaseIntegral membrane proteinVariable across methanogen lineages

The high conservation of mtrE sequences, particularly the AEDLESDVGSQSNPNSQVQLAPQM motif, suggests a crucial role that has been maintained throughout the evolution of methanogenic archaea .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.