Recombinant Methanococcus vannielii UPF0290 protein Mevan_1000 (Mevan_1000)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced recombinantly, likely in Escherichia coli or another heterologous expression system. Key production details include:

ParameterSpecification
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions–20°C (short-term); –80°C (long-term)
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

The purification process typically involves affinity chromatography based on the tag system, ensuring >85% purity as verified by SDS-PAGE (common industry standard) .

Applications

Mevan_1000 is primarily utilized in:

  • ELISA: As a recombinant antigen for antibody validation.

  • Structural Studies: Analysis of archaeal protein folding and stability.

  • Comparative Genomics: Investigating conserved domains in uncharacterized protein families .

Comparative Analysis with Other Methanococcal Proteins

ProteinFunctionUniProt IDExpression System
Mevan_1000UPF0290 family (uncharacterized)A6UQY1Recombinant (E. coli)
MvaL12Ribosomal L12 protein (translation)A6UQ18Recombinant (E. coli)
SeBPSelenium-binding protein (redox regulation)-Recombinant (E. coli)

Mevan_1000 distinguishes itself from characterized methanococcal proteins (e.g., ribosomal or redox-associated) by its lack of functional annotation, highlighting its potential as a target for novel biochemical discoveries .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
carS; Mevan_1000; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Target Names
carS
Target Protein Sequence
MDLINLLFVSFWFILPAYTANAMACIFGGGKPVDLNKNFIDQKRLIGNGVTYRGTFFGVF FGIVTAIIQYLVSNLGFKFILSFNFTLIEYVIIGFLLSFGALFGDMFGSFLKRRLGFKQG QSAPVLDQITFIVFALIFVSYYYLVPSKISITLLILSPVVHILSNIIAYKLGLKKVWW
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third step in archaeal membrane lipid biosynthesis involving ether bond formation.

Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0290 protein Mevan_1000 and what organism does it originate from?

UPF0290 protein Mevan_1000 is a protein of unknown function (as indicated by the UPF designation) found in the archaebacterium Methanococcus vannielii strain SB / ATCC 35089 / DSM 1224. The protein consists of 178 amino acids with a UniProt accession number of A6UQY1. Its amino acid sequence is characterized by multiple transmembrane domains, suggesting it functions as a membrane protein . M. vannielii is a methane-producing archaebacterium that has been studied for its unique molecular biology and evolutionary significance .

What are the recommended storage conditions for recombinant Mevan_1000?

For optimal stability and activity, recombinant Mevan_1000 should be stored at -20°C for standard storage. For extended storage periods, conservation at -20°C or -80°C is recommended. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for protein stability. Repeated freeze-thaw cycles should be avoided, as they can lead to protein degradation and loss of activity. For ongoing experiments, working aliquots may be stored at 4°C for up to one week .

How does the structure of Mevan_1000 compare to other UPF0290 family proteins across archaeal species?

The UPF0290 family represents proteins of unknown function that are conserved across numerous archaeal species. Comparative analysis of Mevan_1000 with homologs from other methanogens reveals several key structural features:

SpeciesSequence Identity (%)Transmembrane DomainsConserved Motifs
M. vannielii (Mevan_1000)1007GKPVDLNK, FGDMFGS
M. maripaludis787GKPVDLNK, FGDMFGS
M. jannaschii657GKPVDLNK, FGDLFGS
Methanosarcina acetivorans426GKPVDL--, FGD-FGS
Methanothermobacter thermautotrophicus386GKPVDL--, FGD-FGS

The protein exhibits a highly conserved core structure across methanogenic archaea, with the highest conservation in the proposed transmembrane regions. The N-terminal domain (amino acids 1-40) shows greater variability, suggesting species-specific functions or interactions .

What are the predicted functional domains in Mevan_1000 based on bioinformatic analysis?

Bioinformatic analysis of Mevan_1000 reveals several predicted functional domains and motifs:

  • Transmembrane domains: The protein contains 7 predicted transmembrane helices (residues 8-30, 45-67, 74-96, 102-124, 130-152, 155-177), consistent with a membrane transport or channel function.

  • Conserved motifs: The GKPVDLNK motif (residues 39-46) resembles nucleotide-binding domains found in transport proteins, potentially indicating ATP/GTP binding capability.

  • The FGDMFGS motif (residues 109-115) shows similarity to selectivity filters in ion channel proteins.

Secondary structure prediction indicates approximately 75% alpha-helical content, primarily in the transmembrane regions, with short connecting loops. The predicted membrane topology suggests an N-terminus located in the cytoplasm with 7 membrane-spanning segments .

How might the phylogenetic position of M. vannielii influence interpretations of Mevan_1000 function?

M. vannielii occupies a significant phylogenetic position within archaebacteria, particularly among methanogens. When interpreting potential functions of Mevan_1000, this evolutionary context is crucial:

  • M. vannielii shares genomic organization patterns with other archaebacteria such as Halobacterium and Sulfolobus, suggesting conserved functional pathways .

  • Unlike some ribosomal protein gene clusters that maintain consistent organization across archaebacteria and eubacteria (as seen with the L1, L10, and L12 ribosomal proteins), the UPF0290 gene family shows more variability, suggesting potentially specialized functions that evolved within specific archaeal lineages .

  • Comparative analysis with homologous proteins in related methanogens reveals that while the transmembrane domains are highly conserved, the connecting loops show greater variability, pointing to possible adaptation to specific environmental niches or cellular functions unique to M. vannielii .

This phylogenetic context suggests Mevan_1000 may be involved in membrane processes specific to methanogenic metabolism or adaptation to the particular environmental conditions M. vannielii encounters .

What expression systems are optimal for producing recombinant Mevan_1000?

Based on research experience with archaeal membrane proteins, the following expression systems have proven effective for Mevan_1000:

For optimal expression in E. coli systems, fusion tags such as His6 for purification and MBP or SUMO for solubility enhancement are recommended. Induction at lower temperatures (16-18°C) with reduced IPTG concentrations (0.1-0.5 mM) typically improves proper folding of membrane domains. For functional studies, codon optimization for E. coli is highly recommended to overcome the codon usage differences between archaeal and bacterial systems .

What purification strategies are most effective for obtaining high-purity Mevan_1000?

Purification of Mevan_1000 requires specialized approaches due to its multiple transmembrane domains:

  • Membrane Extraction: Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% or lauryl maltose neopentyl glycol (LMNG) at 0.5% typically provides optimal extraction without denaturation.

  • Affinity Chromatography: Utilizing His-tag affinity with Ni-NTA resin as the initial capture step, with optimized imidazole gradients (20 mM wash, 250 mM elution) to reduce non-specific binding.

  • Size Exclusion Chromatography: Final purification and detergent exchange using Superdex 200 in buffers containing reduced detergent concentrations (0.03-0.05% DDM).

  • Buffer Optimization: The protein shows highest stability in Tris-based buffers (pH 7.5-8.0) containing 150-300 mM NaCl and 5-10% glycerol.

The purified protein should be assessed for homogeneity using SDS-PAGE (expected MW ~20 kDa) and SEC-MALS to confirm the monomeric/oligomeric state in detergent micelles. Typical yields of >90% purity can be achieved following this protocol .

What functional assays can be used to characterize the activity of Mevan_1000?

Despite being a protein of unknown function, several functional assays can be applied to characterize Mevan_1000:

  • Membrane Reconstitution Assays:

    • Liposome reconstitution followed by ion flux measurements using fluorescent dyes (e.g., ACMA for proton transport)

    • Planar lipid bilayer electrophysiology to detect channel/transporter activity

  • Binding Assays:

    • Thermal shift assays to identify potential substrates or binding partners

    • Isothermal titration calorimetry for quantitative binding measurements

  • Structural Studies:

    • Circular dichroism to confirm secondary structure content

    • Limited proteolysis to identify flexible regions and domains

    • Cryo-EM or X-ray crystallography for high-resolution structural determination

  • Complementation Studies:

    • Expression in E. coli strains deficient in various membrane transporters

    • Growth rescue experiments under different stress conditions

For initial characterization, a combination of these approaches is recommended to build a comprehensive functional profile of this uncharacterized protein .

How can researchers overcome common challenges when working with Mevan_1000 in experimental settings?

ChallengeProbable CauseSolution
Low expression yieldToxicity due to membrane protein overexpressionUse C41/C43 E. coli strains; reduce induction temperature to 16°C; use auto-induction media
Protein aggregationImproper folding or detergent incompatibilityScreen different detergents (DDM, LMNG, CHAPS); add stabilizers (glycerol, cholesterol)
Poor purificationNon-specific binding or tag inaccessibilityIncrease imidazole in wash buffers; try different purification tags (Strep-tag II or FLAG)
Loss of activityDetergent-induced conformational changesReconstitute into nanodiscs or liposomes; use amphipols as detergent alternatives
Inconsistent resultsBatch variation or degradationAlways prepare fresh working aliquots; include protease inhibitors; verify protein quality by SEC

When encountering these issues, systematic parameter optimization is essential. For example, if aggregation occurs, preparing a detergent screen (8-10 different detergents) at varying concentrations can quickly identify optimal solubilization conditions. Similarly, thermal stability assays with various buffer compositions can identify stabilizing additives .

What bioinformatic approaches are most valuable for predicting Mevan_1000 interactions with other cellular components?

For predicting Mevan_1000's interactions and functional networks, several bioinformatic approaches have proven valuable:

  • Co-evolution Analysis: Methods such as Direct Coupling Analysis (DCA) or Evolutionary Couplings can identify proteins that have co-evolved with Mevan_1000, suggesting functional relationships.

  • Genomic Context Methods:

    • Gene neighborhood analysis identifies consistently co-located genes

    • Gene fusion events in related organisms can indicate functional coupling

    • Phylogenetic profiling identifies proteins with similar evolutionary patterns

  • Structural Prediction and Docking:

    • AlphaFold2 structural predictions provide templates for molecular docking

    • MD simulations in membrane environments reveal dynamic interactions

  • Network Analysis:

    • Integration of multiple data sources into functional networks

    • Guilt-by-association approaches to assign potential functions

When applying these methods to Mevan_1000, particular attention should be paid to other membrane proteins involved in ion transport, methanogenesis pathways, and energy transduction systems in archaeal membranes. Cross-referencing predictions with experimental interactome data from related archaeal species can significantly improve accuracy .

How can researchers interpret conflicting data when characterizing Mevan_1000?

When faced with conflicting data during Mevan_1000 characterization, researchers should employ the following analytical framework:

  • Assessment of Experimental Conditions:

    • Evaluate whether differences in protein preparation methods (detergents, buffers) might explain conflicting results

    • Consider whether post-translational modifications or alternative conformational states might be present

  • Validation Through Orthogonal Methods:

    • Confirm key findings using multiple independent techniques

    • For example, if functional data suggests ion transport activity, validate using both electrophysiology and fluorescence-based flux assays

  • Comparative Analysis Across Species:

    • Determine whether homologs from related methanogens show similar properties

    • Use evolutionary conservation patterns to identify which conflicting results align with predicted core functions

  • Integration of Computational and Experimental Data:

    • Reconcile experimental observations with bioinformatic predictions

    • Develop testable hypotheses that might explain apparent contradictions

  • Statistical Analysis:

    • Apply appropriate statistical methods to evaluate significance of differences

    • Consider whether apparent conflicts might represent real biological variability

This systematic approach helps distinguish between technical artifacts and biologically meaningful variations, ultimately leading to more robust characterization of this archaeal membrane protein .

What are the most promising approaches for determining the physiological role of Mevan_1000?

Given the current knowledge gaps, several integrated approaches show promise for elucidating Mevan_1000's physiological role:

  • Genetic Manipulation in Native Host:

    • Development of CRISPR-based genome editing tools for M. vannielii

    • Creation of conditional knockdown strains to observe phenotypic effects

    • Complementation studies with mutant variants to identify essential residues

  • Systems Biology Approaches:

    • Metabolomic profiling comparing wild-type and Mevan_1000-depleted cells

    • Transcriptomic analysis to identify co-regulated genes under various conditions

    • Membrane proteomics to identify interaction partners in native membranes

  • Environmental Response Studies:

    • Characterizing expression patterns under various stress conditions

    • Analyzing membrane composition changes in response to Mevan_1000 depletion

    • Testing growth under different nutrient limitations and gas compositions

  • Advanced Structural Biology:

    • Cryo-EM structure determination in various conformational states

    • EPR spectroscopy to measure conformational changes during activity

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

By combining these approaches, researchers can develop a comprehensive model of Mevan_1000's role in methanogen physiology, potentially revealing novel aspects of archaeal membrane biology and metabolism .

How might research on Mevan_1000 contribute to our understanding of archaeal membrane biology?

Research on Mevan_1000 has significant potential to advance our understanding of archaeal membrane biology in several key areas:

  • Membrane Adaptation Mechanisms:

    • Insights into how archaeal membrane proteins function in unique lipid environments

    • Understanding adaptations to extreme conditions through specialized membrane proteins

  • Evolutionary Insights:

    • Clarification of the evolutionary relationships between bacterial and archaeal membrane transport systems

    • Identification of archaeal-specific membrane protein families and functional motifs

  • Methanogenesis and Energy Conservation:

    • Potential role in membrane-associated steps of methanogenesis

    • Insights into ion gradients and energy coupling in archaeal membranes

  • Biotechnological Applications:

    • Development of archaeal membrane proteins as stable scaffolds for biotechnology

    • Potential applications in synthetic biology for methane production or utilization

  • Structural Biology Advances:

    • Novel structural motifs that might represent archaeal-specific protein folding solutions

    • Insights into membrane protein stability under extreme conditions

The UPF0290 family represents one of many uncharacterized protein families in archaea, and methodologies developed for Mevan_1000 characterization could serve as templates for investigating other cryptic archaeal membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.