Recombinant Methanococcus voltae Putative cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock
Cat. No.
BT2116275
Source
in vitro E.coli expression system
Synonyms
cbiM; Mvol_1622; Putative cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Quick Inquiry

Description

Introduction

Recombinant Methanococcus voltae Putative Cobalt Transport Protein CbiM (cbiM) is a genetically engineered protein critical for cobalt ion uptake in methanogenic archaea. Cobalt is essential for synthesizing vitamin B12 and other metalloenzymes involved in methanogenesis. This recombinant variant, expressed in E. coli with an N-terminal His tag, enables advanced biochemical studies and industrial applications .

Sequence Features

The protein contains a conserved CX₂CX₂C ferredoxin-like motif, indicative of metal-binding capability . Its transmembrane domains suggest involvement in energy-coupling factor (ECF) transport systems .

Recombinant Expression

  • Host System: E. coli optimized for high-yield soluble expression .

  • Tag: N-terminal His tag for affinity chromatography purification .

  • Reconstitution: Recommended concentration of 0.1–1.0 mg/mL in sterile water with 5–50% glycerol for stability .

Quality Control

  • Purity: Validated via SDS-PAGE and mass spectrometry .

  • Storage Stability: Stable at -20°C/-80°C; avoid repeated freeze-thaw cycles .

Role in Cobalt Transport

CbiM functions as a substrate-capture component of the ECF transporter system, facilitating cobalt uptake for biosynthesis of cobalt-dependent enzymes like methyltransferases .

Regulatory Context

  • Genetic Regulation: Co-expressed with FeoAB (Fe²⁺ transporter) and DtxR (metal-sensing transcription factor), suggesting coordinated metal homeostasis .

  • Environmental Response: Upregulated under cobalt limitation, as inferred from proteomic studies of M. voltae grown on FeS₂ or aqueous Fe²⁺/HS⁻ .

Biochemical Studies

  • Metal-Binding Assays: Used to characterize cobalt affinity and transport kinetics .

  • Structural Biology: Serves as a template for crystallography or cryo-EM studies of ECF transporters .

Industrial Relevance

  • Methanogen Engineering: Enhances cobalt uptake in synthetic biology platforms for optimized biogas production .

  • Enzyme Synthesis: Supports in vitro reconstitution of B12-dependent pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cbiM; Mvol_1622; Putative cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Methanococcus voltae (strain ATCC BAA-1334 / A3)
Target Names
cbiM
Target Protein Sequence
MHIMEGYLPMEWAIVWYIISAIVVGYGILNLNKVLKNNPEAKPLLAISGAFMFVLSSLKL PSVSGSCSHPTGNGLGAILFGPAITSVLATIVLLFQALVLAHGGISTLGANIFSMGIMGP FVGYLVFKALRGKLNITWVVMLTAIFADWATYLTTSIQLALAFPVPDFMSSFTEFGTIFA ITQIPLAIAEGLITALLWDYLSELRPELFEKITNIKKGGNNE
Uniprot No.
D7DR00

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links

KEGG: mvo:Mvol_1622

STRING: 456320.Mvol_1622

Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.