Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 1 (cbiM1)

Shipped with Ice Packs

In Stock

Cat. No.

BT2062019

Source

in vitro E.coli expression system

Synonyms

cbiM1; Mlab_0380; Putative cobalt transport protein CbiM 1; Energy-coupling factor transporter probable substrate-capture protein CbiM 1

Quick Inquiry

Description

Production and Biochemical Characteristics

cbiM1 is produced via recombinant expression in E. coli, with an N-terminal His-tag for purification and detection. Key parameters include:

Parameter	Value	Source
Protein Length	Full-length (1-231 amino acids)
Purity	>90% (SDS-PAGE verified)
Storage Buffer	Tris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions	Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw
Reconstitution Recommendations	Deionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol for stability

The protein is commercially available in lyophilized or liquid forms, with applications in structural studies, enzymatic assays, and ELISA-based research .

Functional Role in Transport

Component	Role	Interaction
cbiM (cbiM1)	Substrate capture (cobalt)	Binds CbiQO, stimulates ATPase
CbiQ (EcfT)	Membrane scaffold	Couples cbiM and CbiO
CbiO (EcfA)	ATP-binding/hydrolysis component	Regulates conformational changes

The transport mechanism involves coordinated rotation of CbiQ and CbiM, driven by ATP binding and hydrolysis .

Research Applications and Biological Relevance

cbiM1 is integral to studying cobalt-dependent metabolic pathways and host-microbe interactions:

Metabolic Pathways

Methanogenesis: M. labreanum uses cobalt-containing enzymes (e.g., methyl-coenzyme M reductase) for methane production. cbiM1 may enable cobalt acquisition, supporting this process .
Host Adaptation: Host-associated Methanocorpusculum species (e.g., M. vombati, M. petauri) rely on nutrient uptake systems like ECF transporters for survival in symbiotic niches .

Experimental Models

Application	Method	Outcome
Structural Analysis	X-ray crystallography, cryo-EM	Resolved inward-open conformation
Enzymatic Assays	ATPase activity measurements	Quantified cbiM1’s role in ATP hydrolysis
Host-Symbiont Studies	Comparative genomics, metagenomics	Identified cbiM1 homologs in host-adapted strains

Comparative Genomic and Evolutionary Context

M. labreanum and related species exhibit distinct genetic adaptations:

Feature	Environmental Strains	Host-Associated Strains
Cobalt Transporters	Limited ECF transporter diversity	Enriched for cbiM1 homologs
Metabolic Flexibility	Utilize hydrogen, formate, CO₂	Specialized for host-derived substrates
Phylogeny	Separate clade (environmental)	Host clades 1 and 2

These differences highlight cbiM1’s potential role in host-specific nutrient acquisition .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements to the best of our ability.

Lead Time

Delivery time may vary based on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.

Shelf Life

Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during the manufacturing process.

The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.

Synonyms

cbiM1; Mlab_0380; Putative cobalt transport protein CbiM 1; Energy-coupling factor transporter probable substrate-capture protein CbiM 1

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-231

Protein Length

full length protein

Species

Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)

Target Names

cbiM1

Target Protein Sequence

MHFMDGFLPIGWCVFWAVLAAPFLIYGMWKITKMINNDRHVLPLMAVCGAFIFVVSLVDI PSPTGSCSHPTGTGLSASFFGPAVTSVLGLIILVFQALLLGHGGFTTLGATAFSMAVMGP LAAWLVFKGLRKTGRVPLGPAVFCAAVVANCVTYLITSLQIALAYPVEGSVLTAFLAAAA VFAVVQIPISIIEGIISGLVATYIARIKPEILQKLGVISGEEVKKVLSEQA

Uniprot No.

A2SQF0

Target Background

Function

This protein is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which plays a crucial role in cobalt import.

Database Links

KEGG: mla:Mlab_0380

STRING: 410358.Mlab_0380

Protein Families

CbiM family

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 1 (cbiM1)

Description

Production and Biochemical Characteristics

Functional Role in Transport

Research Applications and Biological Relevance

Metabolic Pathways

Experimental Models

Comparative Genomic and Evolutionary Context

Product Specs

Target Background

Quick Inquiry

Category

Service