Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 2 (cbiM2)

Shipped with Ice Packs
In Stock

Description

Protein Overview

cbiM2 (UniProt ID: A2SSE8) is a 231-amino acid protein encoded by the mlab_1085 gene in Methanocorpusculum labreanum. Key characteristics include:

PropertySpecification
Expression SystemE. coli
TagN-terminal 10xHis
Molecular Weight~26 kDa (calculated)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for storage

The amino acid sequence includes conserved domains critical for cobalt binding and transmembrane transport:
MHIMEGYLPIGWCIFWAVLSAPFVIYGIWKMTKMIQEDRRVLPLMAVCGAFVFVLSALKIPSVTGSCSHPTGTGLSAAFFGPFITSVLGTIVLLFQALLLAHGGLTTLGANVFSMAIAGPFIAWLVFVGLRKTGKVGIGVAVFITAAVANLVTYTVTSLQLALVFPVEGSILNAFIAFAGIFAVTQIPLAIIEGIICALVAKYIVRVKPEILKKLGIIQDEEIAKIQGEAV .

Role in Cobalt Transport

cbiM2 functions as the substrate-capture component (EcfS) of the group-I ECF transporter CbiMNQO, which facilitates cobalt uptake. Key mechanistic features:

  • ATPase Activation: cbiM2 stimulates basal ATPase activity in the CbiQO complex (EcfT-EcfA components) .

  • Substrate Gating: The L1 loop of cbiM2 acts as a gate, controlling cobalt access to the transmembrane channel .

  • Conformational Dynamics: Transport involves rotation of CbiQ (scaffold) and cbiM2, coupled to ATP hydrolysis by CbiO (ATPase) .

Comparative Analysis of ECF Transporters

FeatureGroup-I (CbiMNQO)Group-II ECF Transporters
Scaffold ComponentCbiQ (EcfT homolog)EcfT
Substrate SpecificityCobaltVitamins (e.g., riboflavin, thiamine)
Evolutionary CladeEnvironmental MethanocorpusculumHost-associated lineages

Phylogenetic studies place M. labreanum within an environmental clade distinct from host-associated Methanocorpusculum species, suggesting niche-specific adaptations in metal uptake .

Research Applications

  • Mechanistic Studies: Reconstituted CbiMNQO complexes enable ATPase activity assays and transport kinetics measurements .

  • Metal Homeostasis: Used to probe cobalt’s role in methanogenesis and microbial metabolism .

  • Protein Interaction Mapping: ELISA-compatible formulations facilitate binding partner identification .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cbiM2; Mlab_1085; Putative cobalt transport protein CbiM 2; Energy-coupling factor transporter probable substrate-capture protein CbiM 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Target Names
cbiM2
Target Protein Sequence
MHIMEGYLPIGWCIFWAVLSAPFVIYGIWKMTKMIQEDRRVLPLMAVCGAFVFVLSALKI PSVTGSCSHPTGTGLSAAFFGPFITSVLGTIVLLFQALLLAHGGLTTLGANVFSMAIAGP FIAWLVFVGLRKTGKVGIGVAVFITAAVANLVTYTVTSLQLALVFPVEGSILNAFIAFAG IFAVTQIPLAIIEGIICALVAKYIVRVKPEILKKLGIIQDEEIAKIQGEAV
Uniprot No.

Target Background

Function
A component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the recombinant CbiM2 protein from Methanocorpusculum labreanum?

Recombinant CbiM2 (cbiM2) is a putative cobalt transport protein from the archaeon Methanocorpusculum labreanum. It functions as an energy-coupling factor (ECF) transporter's substrate-capture protein and is involved in the uptake of cobalt ions, which are essential for various metabolic processes in prokaryotic cells . The protein consists of 231 amino acids and is primarily localized in the cell membrane where it participates in metal ion transport activities . In recombinant form, the protein is typically produced with an N-terminal histidine tag to facilitate purification and subsequent experimental analyses .

How does CbiM2 differ from CbiM1?

While both CbiM1 and CbiM2 are putative cobalt transport proteins from Methanocorpusculum labreanum, they exhibit differences in their amino acid sequences that may influence their specific functions and interactions:

FeatureCbiM1CbiM2
UniProt IDA2SQF0A2SSE8
Gene LocusMlab_0380Mlab_1085
Amino Acid Length231231
Sequence SimilarityHas unique sequence variationsHas unique sequence variations
N-terminal RegionDifferent arrangement of hydrophobic residuesDifferent arrangement of hydrophobic residues

Despite these differences, both proteins retain the essential structural features required for cobalt transport function . The presence of two distinct CbiM proteins (CbiM1 and CbiM2) in M. labreanum suggests potential functional specialization or differential expression under varying environmental conditions.

What experimental techniques are most effective for studying CbiM2 function?

Several experimental approaches have proven effective for investigating CbiM2 function:

  • Electron Paramagnetic Resonance (EPR) Analysis: This technique has been successfully applied to study the structural organization of protein loops after site-directed spin labeling. For CbiM proteins, EPR analysis can reveal ordered structures in extracytoplasmic loops and monitor changes in protein dynamics during transport activity .

  • Solid-State Nuclear Magnetic Resonance (NMR): This method allows examination of isotope-labeled proteins in proteoliposomes, providing insights into the dynamics of active versus inactive forms of the protein. Studies have shown decreased dynamics in inactive CbiM variants with loop deletions .

  • Cysteine-Scanning Mutagenesis and Crosslinking: These techniques can verify predicted protein-protein interactions, particularly between CbiM and accessory proteins like CbiN. By introducing cysteine residues at specific positions and monitoring crosslinking, researchers can map interaction interfaces .

  • Transport Assays in Reconstituted Systems: Functional analysis of cobalt transport can be performed using proteoliposomes containing purified CbiM2, with radioactive cobalt ions as tracers to measure transport kinetics and specificity .

How can the recombinant CbiM2 protein be properly stored and handled?

Proper storage and handling of recombinant CbiM2 protein are crucial for maintaining its structural integrity and functional activity. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . When preparing for experiments, it is recommended to:

  • Briefly centrifuge the vial before opening to ensure the protein powder is at the bottom of the container .

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage and aliquot to avoid repeated freeze-thaw cycles .

  • Store working aliquots at 4°C for up to one week, as repeated freezing and thawing can significantly reduce protein activity .

  • When reconstituting membrane proteins like CbiM2, consider adding mild detergents to maintain solubility without disrupting native conformation.

How does CbiM2 interact with CbiN in cobalt transport systems?

The interaction between CbiM and CbiN is critical for cobalt transport functionality. CbiN, a membrane protein composed of two transmembrane helices connected by an extracytoplasmic loop of 37 amino acid residues, serves as an auxiliary component that temporarily interacts with the CbiM component of the CbiMQO₂ Co²⁺ transporter .

Key aspects of this interaction include:

  • Loop-Loop Interactions: The extracytoplasmic loop of CbiN interacts with loops in CbiM, facilitating metal insertion into the binding pocket. Any deletion in the CbiN loop has been shown to abolish transport activity .

  • Structural Dynamics: The N-terminal loop of CbiM, which contains three of the four metal ligands, becomes partially immobilized when interacting with wild-type CbiN but is completely immobile in inactive variants with CbiN loop deletions .

  • Functional Significance: CbiN has been demonstrated to induce significant Co²⁺ transport activity even in the absence of CbiQO₂ components when co-expressed with CbiM or as a Cbi(MN) fusion protein .

These interactions highlight the sophisticated molecular mechanisms underlying cobalt transport and suggest that CbiN may help configure the metal binding site in CbiM to facilitate ion capture and transfer.

What is the mechanism of cobalt binding and transport by CbiM2?

The cobalt binding and transport mechanism by CbiM2 involves several coordinated steps:

  • Metal Recognition: The binding pocket of CbiM2 contains specific metal ligands that selectively coordinate with cobalt ions. Three of these four metal ligands are located in the N-terminal loop of CbiM .

  • Conformational Changes: The S component (CbiM) of ECF transporters undergoes rotation within the membrane to alternately expose the binding pocket to the exterior and cytoplasm . This conformational change is essential for translocating bound cobalt ions across the membrane barrier.

  • Accessory Protein Assistance: Unlike vitamin transporters, metal-specific ECF transporters require additional proteins such as CbiN for optimal function . The interaction between CbiM and CbiN facilitates metal insertion into the binding pocket through specific loop-loop interactions.

  • Energy Coupling: The complete cobalt transporter (CbiMQO₂) couples the transport process to ATP hydrolysis through the associated ATPase components (CbiO), providing the energy required for active transport against concentration gradients .

The transport mechanism appears to involve dynamic interactions that temporarily adjust the configuration of the metal binding site to optimize cobalt capture and subsequent translocation across the membrane.

How can site-directed mutagenesis be used to study CbiM2 function?

Site-directed mutagenesis represents a powerful approach for investigating the functional significance of specific amino acid residues in CbiM2:

  • Identification of Critical Residues: By systematically replacing amino acids in predicted metal-binding sites or interaction interfaces with alanine or other amino acids, researchers can identify residues essential for cobalt transport activity .

  • Cysteine-Scanning Mutagenesis: This specialized approach involves introducing cysteine residues at specific positions throughout the protein. These cysteines can then be labeled with spin labels for EPR studies or used for crosslinking experiments to map interaction surfaces .

  • Loop Modification Studies: Creating deletions or substitutions in the loops of CbiM2 can provide insights into regions involved in interactions with CbiN and other components of the transport system. Studies have shown that modifications to the N-terminal loop containing metal ligands significantly impact protein function .

  • Fusion Protein Analysis: Constructing Cbi(MN) fusion proteins allows for the investigation of how physical linkage between CbiM and CbiN affects transport activity and provides a system for studying the effects of mutations in either protein component .

The results from mutagenesis studies should be analyzed not only for functional effects (transport activity) but also for impacts on protein structure, stability, and interactions with other components of the transport system.

How can contradictions in CbiM2 functional data be systematically analyzed?

When confronted with contradictory data regarding CbiM2 function, researchers should implement a structured approach to contradiction analysis:

  • Parameter-Based Contradiction Notation: Consider adopting a structured notation system like the (α, β, θ) parameter framework, where α represents the number of interdependent items, β indicates the number of contradictory dependencies defined by domain experts, and θ reflects the minimal number of required Boolean rules to assess these contradictions .

  • Multidimensional Analysis: Examine contradictions from multiple perspectives, including experimental conditions, protein preparation methods, membrane environment composition, and assay systems used across different studies .

  • Boolean Minimization: Apply Boolean logic to reduce complex sets of contradictory observations to their minimal representation, which may reveal underlying patterns or conditions that reconcile apparently conflicting results .

  • Domain Knowledge Integration: Combine specific biomedical domain knowledge with informatics approaches to efficiently implement assessment tools that can evaluate complex interdependencies in experimental data .

By applying such systematic approaches, researchers can better manage the complexity of multidimensional interdependencies within datasets related to CbiM2 function and potentially resolve apparent contradictions through identification of previously unrecognized variables or conditions.

What techniques are appropriate for studying CbiM2 in membrane environments?

Given that CbiM2 is a membrane protein, specialized techniques are required to study its structure and function in appropriate membrane environments:

  • Proteoliposome Reconstitution: Purified CbiM2 can be incorporated into artificial lipid vesicles to create a controlled membrane environment for functional studies. Solid-state NMR and other spectroscopic techniques can then be applied to these proteoliposomes to investigate protein dynamics and activity .

  • Detergent Selection: For structural studies, careful selection of detergents is crucial. Different detergents may be required for extraction, purification, and functional reconstitution to maintain protein integrity and native conformation.

  • Native Membrane Studies: Expression of CbiM2 in appropriate host systems followed by isolation of membrane fractions can allow for studies in a more native-like environment. This approach can be particularly valuable for examining interactions with other membrane components.

  • Membrane Mimetic Systems: Nanodiscs, bicelles, or amphipols can provide alternative membrane mimetic environments that may be more suitable for certain analytical techniques while still maintaining a lipid bilayer-like environment for the protein.

When interpreting results from these different experimental systems, it is important to consider how the membrane environment might influence protein structure, dynamics, and function.

What are the emerging approaches for studying cobalt transport protein dynamics?

Several cutting-edge approaches are emerging as valuable tools for studying the dynamics of cobalt transport proteins like CbiM2:

  • Single-Molecule Tracking: This technique allows for real-time observation of individual protein molecules, providing insights into transport mechanisms and conformational changes that may not be apparent in ensemble measurements.

  • Cryo-Electron Microscopy: Recent advances in cryo-EM resolution make it increasingly applicable to membrane protein complexes, potentially enabling visualization of CbiM2 alone or in complex with other transport components.

  • Molecular Dynamics Simulations: Computational approaches can model the behavior of CbiM2 in lipid bilayers, predicting conformational changes associated with metal binding and transport that can guide experimental work.

  • Time-Resolved Spectroscopy: These methods can capture transient states during the transport cycle, revealing intermediate conformations and the kinetics of structural transitions.

The integration of these advanced approaches with established techniques like EPR and solid-state NMR will likely provide more comprehensive insights into the dynamic processes underlying cobalt transport by CbiM2 .

How does the study of CbiM2 contribute to understanding broader cobalt transport systems?

Research on CbiM2 has significant implications for understanding broader cobalt transport systems in prokaryotes:

  • ECF Transporter Mechanisms: CbiM2 studies provide insights into the general mechanisms of ECF transporters, particularly those involved in transitional metal ion uptake, which differ from vitamin transporters in their requirement for auxiliary components like CbiN .

  • Metal Ion Selectivity: Understanding how CbiM2 selectively binds cobalt can inform research on metal selectivity in other transport systems, addressing fundamental questions about how cells discriminate between similar metal ions.

  • Prokaryotic Metal Homeostasis: The cobalt transport system involving CbiM2 is part of the broader network of proteins involved in metal homeostasis in M. labreanum and other prokaryotes. Genomic analysis has identified 17 proteins involved in cobalt transport and assimilation processes in related organisms .

  • Evolution of Transport Systems: Comparative analysis of CbiM proteins across different species can provide insights into the evolution of metal transport systems and their adaptation to different environmental niches.

By positioning CbiM2 research within this broader context, researchers can contribute to a more comprehensive understanding of metal transport mechanisms and their importance in prokaryotic physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.