Recombinant Methanocorpusculum labreanum UPF0059 membrane protein Mlab_0221 (Mlab_0221)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocorpusculum labreanum UPF0059 Membrane Protein Mlab_0221

The Recombinant Methanocorpusculum labreanum UPF0059 membrane protein Mlab_0221 (UniProt ID: A2SPZ1) is a full-length, His-tagged protein expressed in E. coli. This protein belongs to the UPF0059 family and is annotated as a putative manganese efflux pump (MntP) involved in metal ion transport . Its function and structural characteristics make it a subject of interest in microbial physiology and biotechnological applications.

Functional Annotations

  • Gene Family: MntP (TC 9.B.29), a transmembrane efflux pump for manganese ions .

  • Subcellular Localization: Cell membrane; multi-pass membrane protein .

  • Proposed Role: Manganese efflux pump, critical for maintaining intracellular metal homeostasis in Methanocorpusculum labreanum .

Recombinant Protein Production

  1. Hydrophobic Regions: Transmembrane domains may expose hydrophobic residues, leading to aggregation or misfolding .

  2. Folding Requirements: Proper folding depends on chaperones and lipid bilayer mimicry, which may not be fully replicated in heterologous systems .

  3. Toxicity: Overexpression of membrane proteins can stress E. coli cells, reducing yield .

Quality Control Measures

  • Purity Assessment: SDS-PAGE confirms >90% purity, with minor contaminants likely representing degradation products or host proteins .

  • Stability: Lyophilized protein requires storage at -20°C/-80°C and avoids repeated freeze-thaw cycles .

Functional Studies

  • Metal Ion Transport: The MntP family is implicated in manganese detoxification, a process critical for microbial survival in environments with fluctuating metal concentrations .

  • ELISA Applications: Recombinant Mlab_0221 is used in immunoassays to detect antibodies or quantify protein levels .

Computational Tools for Analysis

  • mCSM-membrane: A web server for predicting the effects of mutations on membrane protein stability and pathogenicity . While not directly applied to Mlab_0221, this tool could aid in studying structure-function relationships.

Host Organism Overview

  • Methanocorpusculum labreanum: A methanogenic archaeon isolated from freshwater environments, including the La Brea Tar Pits .

  • Metabolic Traits:

    • Reduces CO₂ to methane using H₂ or formate .

    • Lacks acetate utilization pathways .

Genomic Insights

  • Genome Size: ~1.8 Mb (strain Z), with 1,739 protein-coding genes .

  • Hydrogenase Systems: Contains Eha and Ech hydrogenases, involved in energy conversion and redox balance .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please specify your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
mntP; Mlab_0221; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Target Names
mntP
Target Protein Sequence
MTDLLLSSLVIAVGLAMDSFSVSLAGGAALKDNIVKTAVTAGIFFGFFQFAMPLLGWGIG VPITQVIDPFGYWIVVGLFFFIGGKMIWDSFSGDEEGISLIGWKVLLLLAVATSIDALAV GISFALIGEAVLLPAVIIGVVAFLFSFFGVLAGHKLSSILGNKMQILGGVILVLIGIKFL IEYCL
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocorpusculum labreanum UPF0059 membrane protein Mlab_0221 and what is its biological significance?

Methanocorpusculum labreanum UPF0059 membrane protein Mlab_0221 (UniProt ID: A2SPZ1) is a membrane protein comprising 185 amino acids that functions as a putative manganese efflux pump (MntP) . The protein belongs to the UPF0059 family of membrane proteins and plays a critical role in metal ion homeostasis within methanogenic archaea. As a membrane-integrated protein, Mlab_0221 contains multiple transmembrane domains that facilitate the transport of manganese ions across cellular membranes. The protein's study is significant for understanding manganese homeostasis in archaea and potentially providing insights into analogous mechanisms in other organisms. Comparative analysis with homologous proteins in bacteria and eukarya can elucidate evolutionary relationships in metal ion transport systems.

How does Mlab_0221 compare to other UPF0059 family proteins in different organisms?

The UPF0059 family represents proteins of unknown function that share conserved sequence patterns. Comparative analysis of Mlab_0221 with other UPF0059 family members reveals several conserved domains that likely play crucial roles in metal ion transport. Sequence alignment studies show that Mlab_0221 shares significant homology with bacterial manganese transporters, particularly in the transmembrane regions and metal-binding domains. The conservation of these domains across phylogenetically distant organisms suggests their functional importance in manganese homeostasis.

When comparing Mlab_0221 to other UPF0059 family proteins, researchers should employ multiple sequence alignment tools such as CLUSTAL Omega or MUSCLE to identify conserved residues. Phylogenetic analysis can then be performed to establish evolutionary relationships between these proteins across different domains of life. Structural modeling using tools like Swiss-Model or I-TASSER can further elucidate structural similarities and differences that might impact function.

What expression systems and conditions are optimal for producing recombinant Mlab_0221?

The recombinant expression of Mlab_0221 has been successfully achieved in E. coli systems . When designing expression experiments, researchers should consider several factors to optimize protein yield and quality:

  • Vector Selection: For membrane proteins like Mlab_0221, vectors containing strong but inducible promoters (such as T7) are recommended. The addition of a His-tag at the N-terminus facilitates purification while minimizing interference with membrane insertion.

  • Host Strain Selection: E. coli strains BL21(DE3), C41(DE3), or C43(DE3) are particularly suitable for membrane protein expression. C41 and C43 strains were specifically developed for toxic membrane protein expression.

  • Induction Conditions: Lowering the induction temperature to 18-25°C and using lower IPTG concentrations (0.1-0.5 mM) can enhance proper folding of membrane proteins.

  • Media Composition: Supplementing growth media with glycerol (0.5-1%) can improve membrane protein expression by providing additional carbon sources and promoting membrane development.

  • Co-expression with Chaperones: Co-expressing molecular chaperones such as GroEL/GroES can aid in proper folding of complex membrane proteins.

The experimental design should include control conditions and systematic optimization of these parameters. Western blotting and activity assays should be employed to assess not just quantity but also quality and functional state of the expressed protein.

What purification strategies maximize yield and maintain functionality of His-tagged Mlab_0221?

Purification of His-tagged Mlab_0221 requires specialized approaches due to its membrane-embedded nature. The following methodological approach ensures optimal results:

  • Membrane Extraction: Begin with gentle cell lysis using methods that preserve membrane integrity (such as French press or sonication with cooling intervals). Separate membrane fractions through ultracentrifugation (typically 100,000 × g for 1 hour).

  • Detergent Solubilization: Carefully select detergents for membrane protein solubilization. For Mlab_0221, non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% or digitonin at 0.5-1% are recommended. Incubate membranes with the detergent at 4°C with gentle rotation for 1-2 hours.

  • Affinity Chromatography: Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resins. Include low concentrations of detergent (0.05-0.1%) in all buffers to maintain protein solubility. A typical purification buffer might contain:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 0.05% DDM

    • 20-250 mM imidazole (for washing and elution gradients)

  • Size Exclusion Chromatography: Further purify the protein using size exclusion chromatography to remove aggregates and ensure homogeneity. Monitor protein quality using SDS-PAGE to verify >90% purity as typically achieved with this protocol .

  • Functional Verification: Assess protein functionality through manganese transport assays or binding studies to ensure the purification process has not compromised biological activity.

What reconstitution methods are recommended for lyophilized Mlab_0221 to maintain structural integrity?

Proper reconstitution of lyophilized Mlab_0221 is crucial for downstream applications. The following methodological approach is recommended:

  • Initial Preparation: Centrifuge the vial containing lyophilized protein briefly to collect all material at the bottom before opening .

  • Reconstitution Buffer: Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For functional studies, consider buffers that mimic physiological conditions:

    • 20 mM HEPES, pH 7.4

    • 150 mM NaCl

    • 0.05% suitable detergent (DDM or equivalent)

  • Reconstitution Process: Add the buffer slowly to the sides of the vial rather than directly onto the protein powder. Allow the protein to hydrate for 5-10 minutes at room temperature before gentle mixing.

  • Storage Considerations: For long-term storage, add glycerol to a final concentration of 5-50% and aliquot the reconstituted protein to avoid repeated freeze-thaw cycles . Store at -20°C/-80°C for maximum stability.

  • Quality Control: Verify protein integrity after reconstitution using techniques such as circular dichroism (CD) spectroscopy to assess secondary structure or dynamic light scattering (DLS) to detect aggregation.

How can researchers design experiments to investigate Mlab_0221 function as a putative manganese efflux pump?

Investigating the manganese transport function of Mlab_0221 requires sophisticated experimental designs that combine molecular, cellular, and biophysical approaches:

  • Site-Directed Mutagenesis Studies: Identify conserved residues potentially involved in manganese binding through bioinformatic analysis and create systematic mutations. Particularly focus on negatively charged residues (Asp, Glu) and histidines that typically coordinate metal ions. Test each mutant for transport activity to determine essential residues for function.

  • Manganese Transport Assays: Design assays using reconstituted proteoliposomes containing purified Mlab_0221. Load liposomes with a manganese-sensitive fluorescent indicator (such as California Green 5N) and monitor fluorescence changes in response to external manganese addition. Transport can be measured as:

    Transport Rate=ΔFluorescenceΔTime×Calibration Factor\text{Transport Rate} = \frac{\Delta \text{Fluorescence}}{\Delta \text{Time}} \times \text{Calibration Factor}

  • Electrophysiological Studies: Utilize patch-clamp techniques or planar lipid bilayer recordings to measure ion conductance associated with Mlab_0221 activity. Compare conductance values in the presence of different divalent cations to establish specificity.

  • Competitive Binding Studies: Design experiments using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine binding affinities for manganese compared to other divalent cations. A systematic experimental design might include:

Metal IonConcentration Range (μM)Expected KD if Mn²⁺-specificNumber of Replicates
Mn²⁺0.1-1000.1-10 μM3
Zn²⁺0.1-100>50 μM3
Fe²⁺0.1-100>50 μM3
Ca²⁺0.1-100>100 μM3
Mg²⁺0.1-100>100 μM3
  • In vivo Complementation Studies: Design experiments using manganese-sensitive bacterial strains with disrupted endogenous manganese transport systems. Express Mlab_0221 and assess whether it can rescue growth under manganese stress conditions.

What advanced experimental designs can elucidate the membrane topology and structural dynamics of Mlab_0221?

Understanding the membrane topology and structural dynamics of Mlab_0221 requires sophisticated biophysical and biochemical approaches:

  • Cysteine Scanning Mutagenesis: Design a systematic experimental approach by replacing amino acids sequentially with cysteine residues. Then use membrane-impermeant thiol-reactive reagents to determine which residues are accessible from which side of the membrane, thereby mapping the topology.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Design HDX-MS experiments to identify regions of Mlab_0221 that are protected from solvent exchange when embedded in membranes. This reveals transmembrane regions and provides insights into conformational dynamics during transport cycles.

  • Single-Molecule FRET Studies: Engineer pairs of fluorophores at key positions in Mlab_0221 to monitor conformational changes during transport. Design the experiment to include:

    • Control measurements with non-functional mutants

    • Measurements in the presence and absence of manganese

    • Varying concentrations of manganese to establish dose-response relationships

  • Molecular Dynamics Simulations: Design computational experiments to model Mlab_0221 in a lipid bilayer environment. Simulate:

    • Protein stability in different membrane compositions

    • Potential manganese binding sites and transport pathways

    • Conformational changes associated with transport

  • Cryo-EM Analysis: Design experiments to determine the structure of Mlab_0221 at high resolution using single-particle cryo-electron microscopy. The experimental design should address:

    • Detergent selection for optimal protein extraction

    • Grid preparation optimization

    • Image acquisition parameters

    • Data processing workflow

How can researchers design experiments to investigate potential interactions between Mlab_0221 and other cellular components?

Investigating protein-protein interactions involving Mlab_0221 requires well-designed experiments combining biochemical, genetic, and imaging approaches:

  • Pull-Down Assays and Co-Immunoprecipitation: Design experiments using His-tagged Mlab_0221 as bait to identify interacting proteins from Methanocorpusculum labreanum lysates. Analysis using mass spectrometry can identify potential binding partners.

  • Bacterial Two-Hybrid Screening: Adapt bacterial two-hybrid systems for membrane proteins to screen for interactions between Mlab_0221 and other proteins. Design a systematic screening approach targeting:

    • Other transporters involved in metal homeostasis

    • Regulatory proteins that might modulate transporter activity

    • Chaperones involved in membrane protein folding and insertion

  • FRET/BRET Assays in Reconstituted Systems: Design fluorescence or bioluminescence resonance energy transfer experiments to detect and quantify interactions between Mlab_0221 and candidate interacting proteins. Use a systematic experimental design with appropriate controls:

Protein PairExpected InteractionPositive ControlNegative Control
Mlab_0221 + Protein XDirect bindingKnown interacting pairNon-interacting membrane protein
Mlab_0221 + Protein YTransient associationKnown transient interactorsCytosolic protein
Mlab_0221 + Protein ZNo interactionKnown interacting pairSame proteins, inhibitory conditions
  • Surface Plasmon Resonance (SPR): Design SPR experiments to quantify binding kinetics between Mlab_0221 and potential interacting partners. For membrane proteins, this requires careful consideration of:

    • Immobilization strategy (His-tag capture vs. direct coupling)

    • Detergent selection to maintain protein stability

    • Regeneration conditions that preserve protein activity

  • Proximity Labeling Methods: Design experiments using BioID or APEX2 fused to Mlab_0221 to identify proximity partners in vivo. This approach captures even transient interactions that might be missed by traditional pull-down methods.

What experimental design principles should be applied when studying Mlab_0221 to ensure reliable and reproducible results?

When designing experiments involving Mlab_0221, researchers should incorporate key experimental design principles to maximize reliability and reproducibility:

  • Appropriate Controls: Include positive controls (known membrane transporters), negative controls (non-functional mutants), and procedural controls for each experiment. For example, when assessing manganese transport, include a known manganese transporter as a positive control and a water channel (non-metal transporter) as a negative control.

  • Blocking Strategies: Implement blocking to account for batch effects in protein preparation or assay conditions . For instance, when performing transport assays across multiple protein preparations, ensure each experimental condition is tested with each protein batch.

  • Randomization: Apply randomization to minimize systematic errors. For example, when measuring transport kinetics under various conditions, randomize the order of measurements rather than proceeding systematically from lowest to highest concentration.

  • Replication Strategy: Design experiments with both technical replicates (repeated measurements of the same sample) and biological replicates (independent protein preparations). For Mlab_0221 studies, aim for:

    • Minimum 3 biological replicates (independent protein preparations)

    • 3-5 technical replicates per biological replicate

  • Statistical Power Analysis: Determine appropriate sample sizes before conducting experiments. For detecting a 25% difference in transport activity with 80% power at α=0.05, sample size calculation might yield:

    n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2 \sigma^2}{\Delta^2}

    Where σ is the standard deviation and Δ is the expected difference.

  • Blinding Procedures: Implement blinding when scoring subjective outcomes, such as localization patterns in microscopy studies or when analyzing complex datasets to prevent unconscious bias.

How can researchers design experiments to distinguish between membrane insertion efficiency and transport activity of Mlab_0221?

Distinguishing between membrane insertion and functional transport activity requires carefully designed experimental protocols:

  • Membrane Insertion Assays: Design experiments using multiple complementary approaches:

    • Protease protection assays: Expose Mlab_0221-containing membranes to proteases and analyze protected fragments

    • Fluorescence quenching: Attach environment-sensitive fluorophores at key positions and monitor changes in fluorescence upon membrane insertion

    • Density gradient fractionation: Separate membrane fractions and detect Mlab_0221 using Western blotting

  • Functional Transport Assays: Design assays that directly measure manganese transport:

    • Radioactive ⁵⁴Mn²⁺ uptake into proteoliposomes

    • Fluorescence-based assays using manganese-sensitive dyes

    • Indirect assays measuring manganese-dependent growth rescue

  • Correlation Analysis: Design experiments to systematically vary membrane insertion conditions and measure both insertion efficiency and transport activity. Calculate correlation coefficients to determine relationship:

    r=(XiXˉ)(YiYˉ)(XiXˉ)2(YiYˉ)2r = \frac{\sum(X_i - \bar{X})(Y_i - \bar{Y})}{\sqrt{\sum(X_i - \bar{X})^2}\sqrt{\sum(Y_i - \bar{Y})^2}}

    Where X represents insertion efficiency and Y represents transport activity.

  • Structure-Function Analysis: Design mutagenesis experiments targeting:

    • Residues predicted to be involved in membrane insertion but not transport

    • Residues predicted to be involved in transport but not membrane insertion

    • Residues predicted to affect both processes

What are the recommended experimental controls and validation strategies when working with Mlab_0221?

Robust experimental design for Mlab_0221 research requires comprehensive controls and validation strategies:

  • Protein Quality Controls:

    • SDS-PAGE with Coomassie staining to verify >90% purity

    • Western blotting using anti-His antibodies to confirm identity

    • Circular dichroism to verify secondary structure integrity

    • Size exclusion chromatography to assess homogeneity

  • Expression System Controls:

    • Empty vector controls for expression experiments

    • Positive control protein (known well-expressed membrane protein)

    • Negative control (known toxic or poorly expressing protein)

  • Functional Assay Controls:

    • Known manganese transporters as positive controls

    • Transport-deficient mutants as negative controls

    • Heat-denatured Mlab_0221 as procedural control

    • Metal chelators (EDTA) to verify metal-dependence of observed effects

  • Specificity Validation:

    • Compare transport rates across multiple divalent cations

    • Perform dose-response experiments with varying manganese concentrations

    • Test competitive inhibition with other metals

  • Complementary Methodologies: Design experiments using multiple independent techniques to validate findings. For example, if manganese binding is detected using isothermal titration calorimetry, validate with microscale thermophoresis and manganese-dependent protein stabilization assays.

What are common challenges in Mlab_0221 research and how can they be methodologically addressed?

Research involving membrane proteins like Mlab_0221 presents several common challenges that require methodological solutions:

  • Low Expression Yields:

    • Methodological solution: Optimize codon usage for the expression host, reduce expression temperature to 18°C, and test various induction conditions (IPTG concentration and timing).

    • Experimental approach: Design a systematic grid experiment varying induction OD, temperature, IPTG concentration, and harvest time.

  • Protein Aggregation:

    • Methodological solution: Screen multiple detergents for solubilization and purification. Consider adding stabilizing agents like glycerol (5-10%) or specific lipids.

    • Validation approach: Monitor protein aggregation using dynamic light scattering and analytical size exclusion chromatography.

  • Loss of Function During Purification:

    • Methodological solution: Include manganese ions in purification buffers if they stabilize the protein. Maintain constant low levels of appropriate detergent throughout all steps.

    • Control strategy: Test activity at each purification step to identify where function may be compromised.

  • Poor Reconstitution into Liposomes:

    • Methodological solution: Optimize lipid composition to match the native membrane environment of M. labreanum. Test different protein-to-lipid ratios and reconstitution methods (dialysis vs. direct dilution).

    • Quality control: Verify reconstitution efficiency using freeze-fracture electron microscopy or density gradient centrifugation.

  • Inconsistent Transport Assay Results:

    • Methodological solution: Standardize liposome size using extrusion through defined pore-size filters. Carefully control buffer composition and temperature during assays.

    • Design approach: Implement blocked experimental design to account for batch effects , with positive controls included in each experimental block.

How can researchers optimize experimental conditions for studying manganese transport by Mlab_0221?

Optimizing experimental conditions for manganese transport studies requires systematic investigation of multiple parameters:

  • pH Optimization:

    • Design a systematic pH screening experiment covering the range 5.5-8.5 in 0.5 pH unit increments.

    • For each pH, measure transport activity using standardized assays.

    • Create a pH profile graph plotting activity vs. pH to identify optimal conditions.

  • Lipid Composition Effects:

    • Test reconstitution into liposomes with varying lipid compositions:

      • Pure phosphatidylcholine (PC)

      • PC/phosphatidylethanolamine (PE) mixtures (70:30, 50:50)

      • Addition of archaeal lipid extracts or synthetic archaeal lipid analogs

    • Measure transport activity in each lipid environment

  • Temperature Dependence:

    • Design experiments to measure transport activity across a temperature range (10-50°C in 5°C increments).

    • Calculate activation energy using Arrhenius plots:
      ln(k)=ln(A)EaRT\ln(k) = \ln(A) - \frac{E_a}{RT}

    • Compare with known mesophilic and thermophilic transporters

  • Metal Concentration Optimization:

    • Design a dose-response experiment for manganese transport covering concentrations from 0.1 μM to 10 mM.

    • Fit data to appropriate kinetic models (Michaelis-Menten, Hill equation) to determine Km and Vmax.

    • Experimental design should include sufficient data points to accurately define the curve:

ParameterRecommendationRationale
Concentration range0.1 × Km to 10 × KmEnsures coverage of linear and saturating regions
Number of concentrationsMinimum 8 pointsProvides sufficient data for accurate curve fitting
Replicates per concentration3-5Accounts for experimental variation
Time pointsMultiple (0, 5, 15, 30, 60 min)Ensures measurement in linear range of transport
  • Counter-ion Effects:

    • Design experiments to test if transport is electrogenic (coupled to charge movement) by varying counter-ions.

    • Create ion gradients across liposome membranes and measure their effect on manganese transport rates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.