Recombinant Methanoculleus marisnigri UPF0059 membrane protein Memar_2039 (Memar_2039)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Expression System

  • Host: Escherichia coli

  • Tag: N-terminal His-tag (additional C-terminal tag possible depending on production batch)

Purification & Quality Control

ParameterDetail
Purity>90% (SDS-PAGE verified)
FormLyophilized powder or liquid
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0
Long-term Storage-80°C (aliquots recommended)
Optimized protocols from commercial producers

Functional Insights

Biological Role

  • Acts as a manganese efflux pump (MntP), critical for maintaining intracellular manganese homeostasis in Methanoculleus marisnigri .

  • Phylogenetically conserved in methanogens, suggesting a role in metal ion transport under anaerobic conditions .

Mechanistic Studies

  • Structural modeling indicates 10–12 transmembrane helices, consistent with ion channel functionality .

  • Gene neighborhood analysis reveals proximity to genes encoding hydrogenase and heterodisulfide reductase, implicating potential metabolic linkages in methanogenesis .

Genomic Context in M. marisnigri JR1

Organism Profile

FeatureDetail
HabitatMarine sediment (Black Sea isolate)
MetabolismHydrogenotrophic methanogen
Genome Size2.93 Mb
GC Content59.3%
From strain JR1’s complete genome sequencing

Operonic Associations

  • Located near genes encoding:

    1. Formylmethanofuran dehydrogenase (critical for CO₂ reduction in methanogenesis)

    2. Ech hydrogenase (involved in energy conservation)

Research Applications

  • Metal Homeostasis Studies: Used to probe Mn²⁺/Fe²⁺ transport mechanisms in extremophiles .

  • Structural Biology: Serves as a template for modeling archaeal membrane transporters .

  • Biotechnological Tool: Engineered variants tested for heavy metal bioremediation potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
mntP; Memar_2039; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Target Names
mntP
Target Protein Sequence
MDLVTTLLIAVGLAMDAFAVSISGGATLREERLRWAVIAGALFGGFQAGMPVLGWLGGMG LASFVGTYGPWIAFLLLALIGGKMIAEAVRGDGESVRFENGATVLLLLAVATSIDALAVG VSFAVLDTAIALPAITIGVVTFAFSAAGVLLGSAFGHIMGRKACIVGGIILVGIGLRILL EHLFF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Organism Background and Classification

Methanoculleus marisnigri is a methanogenic archaeon of considerable phylogenetic interest within the Euryarchaeota phylum. The type strain JR1 was isolated from anoxic sediments of the Black Sea and represents one of three phylogenetic families within the order Methanomicrobiales . Its taxonomic classification is structured as follows:

Classification LevelTaxonomic Assignment
DomainArchaea
PhylumEuryarchaeota
Class"Methanomicrobia"
OrderMethanomicrobiales
FamilyMethanomicrobiaceae
GenusMethanoculleus
SpeciesMethanoculleus marisnigri

The genome of M. marisnigri JR1 consists of a single circular chromosome of 2.48 Mbp with a G+C content of 62.1%, which is notably high among methanogens. It contains 2,560 genes with 2,506 protein-coding sequences, making it an intermediate-sized genome compared to other methanogenic archaea . The organism displays physiological characteristics that must be considered when designing experimental conditions, including irregular coccoid morphology, growth temperature range of 15-45°C (optimal at 20-25°C), and the ability to utilize H₂/CO₂ and formate but not acetate or methanol as energy sources .

Protein Structure and Properties

The Memar_2039 protein belongs to the UPF0059 family (Uncharacterized Protein Family) and functions as a membrane protein. The recombinant form available for research has the following properties:

PropertyDescription
UniProt AccessionA3CX65
Protein Length185 amino acids
Expression Region1-185 (full length)
Amino Acid SequenceMDLVTTLLIAVGLAMDAFAVSISGGATLREERLRWAVIAGALFGGFQAGMPVLGWLGGMGLASFVGTYGPWIAFLLLALIGGKMIAEAVRGDGESVRFENGATVLLLLAVATSIDALAVGVSFAVLDTAIALPAITIGVVTFAFSAAGVLLGSAFGHIMGRKACIVGGIILVGIGRILLEHLFF
Commercial FormRecombinant protein, 50 μg quantity
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C (extended storage: -20°C or -80°C)

The amino acid sequence reveals multiple hydrophobic regions consistent with its membrane protein classification . Analysis of the sequence suggests multiple transmembrane helices, which is typical of integral membrane proteins. The function of this protein remains largely uncharacterized, making it an interesting target for structural and functional studies.

Handling and Storage Recommendations

For optimal results when working with recombinant Memar_2039 protein, researchers should adhere to the following handling recommendations:

  • Store stock solutions at -20°C for routine use or at -80°C for extended storage

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity

  • Prepare working aliquots and store at 4°C for up to one week

  • When thawing, allow the protein to warm gradually on ice rather than using rapid heating methods

  • The storage buffer (Tris-based with 50% glycerol) has been optimized for this specific protein

These storage conditions have been specifically optimized to maintain the protein's stability and functional integrity during laboratory use.

Methodological Considerations for UPF0059 Protein Study

Working with archaeal membrane proteins presents unique challenges that require specialized methodological approaches:

Experimental ApproachMethodologyConsiderations for Memar_2039
Structural AnalysisX-ray crystallographyRequires optimization of detergent conditions; consider lipidic cubic phase crystallization
Cryo-electron microscopyIncreasingly valuable for membrane proteins; may reveal native conformational states
Computational predictionTools like AlphaFold can provide structural insights when experimental data is limited
Functional CharacterizationReconstitution in liposomesEssential for studying potential transport functions
ElectrophysiologyApplicable if ion channel activity is suspected
Binding assaysTo identify interaction partners or substrates
Localization StudiesFluorescence microscopyRequires specific antibodies or fluorescent tags
Membrane fractionationCan determine precise membrane localization within the cell
Expression AnalysisqRT-PCRFor studying gene expression under different environmental conditions
ProteomicsTo analyze protein abundance and post-translational modifications

When designing experiments with Memar_2039, researchers should consider the protein's hydrophobic nature and the need to maintain an appropriate membrane-mimetic environment (detergents, nanodiscs, or liposomes) to preserve native structure and function.

Experimental Design for Uncharacterized Proteins

When working with poorly characterized proteins like Memar_2039, a systematic experimental approach is recommended:

  • Begin with bioinformatic analysis to identify conserved domains, potential functional motifs, and structural predictions

  • Design proper controls:

    • Positive controls: well-characterized proteins from related families

    • Negative controls: denatured protein samples and buffer-only conditions

    • Specificity controls: structurally similar but functionally distinct proteins

  • Implement experimental validation through multiple orthogonal techniques:

    • Biochemical assays to test predicted functions

    • Structural studies to reveal potential binding sites

    • Interaction studies to identify binding partners

    • Gene knockout/knockdown studies to assess physiological roles

  • Consider the unique archaeal physiology when interpreting results, particularly the methanogenic lifestyle and adaptation to anoxic environments

This methodical approach helps distinguish true biological functions from experimental artifacts when working with proteins of unknown function.

Relevance to Climate Science and Bioenergy Research

Methanogens like M. marisnigri play crucial roles in global carbon cycling and methane production, making their study relevant to several important research areas:

Research AreaSignificance of M. marisnigri and Membrane Proteins
Climate ScienceMethanogens produce CH₄, a greenhouse gas with ~25× the warming potential of CO₂
Biogas ProductionUnderstanding methanogen physiology can improve bioenergy technologies
Carbon CyclingKey microbes in anaerobic degradation of organic matter in marine sediments
Wastewater TreatmentContribute to anaerobic digestion processes in engineered systems
Microbial EcologyImportant members of anaerobic microbial communities

Membrane proteins like Memar_2039 may play critical roles in the methanogenic metabolism of these organisms, potentially involving energy conservation, substrate uptake, or environmental sensing . Understanding these proteins could lead to improved models of global methane cycling and enhanced biotechnological applications.

Potential Functional Roles of Memar_2039

Based on genomic context and the physiological requirements of M. marisnigri, several hypotheses regarding the function of Memar_2039 can be proposed:

  • Energy conservation: May participate in the unique bioenergetic processes of methanogens

  • Membrane transport: Could function in the uptake of essential nutrients or export of metabolic products

  • Environmental sensing: Might be involved in detecting changes in redox conditions or other environmental parameters

  • Structural role: May contribute to the unique archaeal cell envelope architecture

The genome of M. marisnigri contains several distinctive features, including the presence of both Eha and Ech membrane-bound hydrogenases, suggesting a complex membrane protein complement involved in energy metabolism . Understanding the role of Memar_2039 within this context could provide insights into the adaptations of methanogens to anaerobic environments.

Emerging Technologies in Archaeal Membrane Protein Research

Recent technological advances are transforming our ability to study archaeal membrane proteins:

TechnologyApplication to Memar_2039 Research
Single-particle cryo-EMEnables structural determination without crystallization
Native mass spectrometryCan analyze intact membrane protein complexes
Nanodiscs technologyProvides native-like membrane environment for functional studies
CRISPR-based toolsEmerging genetic systems for archaea enable precise functional studies
Computational methodsImproved prediction of structure, function, and evolutionary relationships

These advanced techniques can overcome traditional challenges in membrane protein research and could provide unprecedented insights into the structure and function of proteins like Memar_2039.

Future Research Directions

Several promising research directions could advance our understanding of Memar_2039:

  • Comparative genomics across archaeal lineages to identify conserved features and evolutionary patterns

  • Integrated multi-omics approaches to correlate expression with environmental conditions

  • Structural biology studies to determine membrane topology and potential binding sites

  • Systems biology approaches to place Memar_2039 in the context of methanogenic metabolism

  • Evolutionary studies to understand the relationship between archaeal membrane proteins and those in bacteria and eukaryotes

These approaches could not only reveal the specific function of Memar_2039 but also contribute to our broader understanding of archaeal physiology and the evolution of membrane proteins across the domains of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.