Acts as a manganese efflux pump (MntP), critical for maintaining intracellular manganese homeostasis in Methanoculleus marisnigri .
Phylogenetically conserved in methanogens, suggesting a role in metal ion transport under anaerobic conditions .
Structural modeling indicates 10–12 transmembrane helices, consistent with ion channel functionality .
Gene neighborhood analysis reveals proximity to genes encoding hydrogenase and heterodisulfide reductase, implicating potential metabolic linkages in methanogenesis .
| Feature | Detail |
|---|---|
| Habitat | Marine sediment (Black Sea isolate) |
| Metabolism | Hydrogenotrophic methanogen |
| Genome Size | 2.93 Mb |
| GC Content | 59.3% |
| From strain JR1’s complete genome sequencing |
Located near genes encoding:
KEGG: mem:Memar_2039
STRING: 368407.Memar_2039
Methanoculleus marisnigri is a methanogenic archaeon of considerable phylogenetic interest within the Euryarchaeota phylum. The type strain JR1 was isolated from anoxic sediments of the Black Sea and represents one of three phylogenetic families within the order Methanomicrobiales . Its taxonomic classification is structured as follows:
| Classification Level | Taxonomic Assignment |
|---|---|
| Domain | Archaea |
| Phylum | Euryarchaeota |
| Class | "Methanomicrobia" |
| Order | Methanomicrobiales |
| Family | Methanomicrobiaceae |
| Genus | Methanoculleus |
| Species | Methanoculleus marisnigri |
The genome of M. marisnigri JR1 consists of a single circular chromosome of 2.48 Mbp with a G+C content of 62.1%, which is notably high among methanogens. It contains 2,560 genes with 2,506 protein-coding sequences, making it an intermediate-sized genome compared to other methanogenic archaea . The organism displays physiological characteristics that must be considered when designing experimental conditions, including irregular coccoid morphology, growth temperature range of 15-45°C (optimal at 20-25°C), and the ability to utilize H₂/CO₂ and formate but not acetate or methanol as energy sources .
The Memar_2039 protein belongs to the UPF0059 family (Uncharacterized Protein Family) and functions as a membrane protein. The recombinant form available for research has the following properties:
| Property | Description |
|---|---|
| UniProt Accession | A3CX65 |
| Protein Length | 185 amino acids |
| Expression Region | 1-185 (full length) |
| Amino Acid Sequence | MDLVTTLLIAVGLAMDAFAVSISGGATLREERLRWAVIAGALFGGFQAGMPVLGWLGGMGLASFVGTYGPWIAFLLLALIGGKMIAEAVRGDGESVRFENGATVLLLLAVATSIDALAVGVSFAVLDTAIALPAITIGVVTFAFSAAGVLLGSAFGHIMGRKACIVGGIILVGIGRILLEHLFF |
| Commercial Form | Recombinant protein, 50 μg quantity |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Storage Conditions | -20°C (extended storage: -20°C or -80°C) |
The amino acid sequence reveals multiple hydrophobic regions consistent with its membrane protein classification . Analysis of the sequence suggests multiple transmembrane helices, which is typical of integral membrane proteins. The function of this protein remains largely uncharacterized, making it an interesting target for structural and functional studies.
For optimal results when working with recombinant Memar_2039 protein, researchers should adhere to the following handling recommendations:
Store stock solutions at -20°C for routine use or at -80°C for extended storage
Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity
Prepare working aliquots and store at 4°C for up to one week
When thawing, allow the protein to warm gradually on ice rather than using rapid heating methods
The storage buffer (Tris-based with 50% glycerol) has been optimized for this specific protein
These storage conditions have been specifically optimized to maintain the protein's stability and functional integrity during laboratory use.
Working with archaeal membrane proteins presents unique challenges that require specialized methodological approaches:
| Experimental Approach | Methodology | Considerations for Memar_2039 |
|---|---|---|
| Structural Analysis | X-ray crystallography | Requires optimization of detergent conditions; consider lipidic cubic phase crystallization |
| Cryo-electron microscopy | Increasingly valuable for membrane proteins; may reveal native conformational states | |
| Computational prediction | Tools like AlphaFold can provide structural insights when experimental data is limited | |
| Functional Characterization | Reconstitution in liposomes | Essential for studying potential transport functions |
| Electrophysiology | Applicable if ion channel activity is suspected | |
| Binding assays | To identify interaction partners or substrates | |
| Localization Studies | Fluorescence microscopy | Requires specific antibodies or fluorescent tags |
| Membrane fractionation | Can determine precise membrane localization within the cell | |
| Expression Analysis | qRT-PCR | For studying gene expression under different environmental conditions |
| Proteomics | To analyze protein abundance and post-translational modifications |
When designing experiments with Memar_2039, researchers should consider the protein's hydrophobic nature and the need to maintain an appropriate membrane-mimetic environment (detergents, nanodiscs, or liposomes) to preserve native structure and function.
When working with poorly characterized proteins like Memar_2039, a systematic experimental approach is recommended:
Begin with bioinformatic analysis to identify conserved domains, potential functional motifs, and structural predictions
Design proper controls:
Positive controls: well-characterized proteins from related families
Negative controls: denatured protein samples and buffer-only conditions
Specificity controls: structurally similar but functionally distinct proteins
Implement experimental validation through multiple orthogonal techniques:
Biochemical assays to test predicted functions
Structural studies to reveal potential binding sites
Interaction studies to identify binding partners
Gene knockout/knockdown studies to assess physiological roles
Consider the unique archaeal physiology when interpreting results, particularly the methanogenic lifestyle and adaptation to anoxic environments
This methodical approach helps distinguish true biological functions from experimental artifacts when working with proteins of unknown function.
Methanogens like M. marisnigri play crucial roles in global carbon cycling and methane production, making their study relevant to several important research areas:
| Research Area | Significance of M. marisnigri and Membrane Proteins |
|---|---|
| Climate Science | Methanogens produce CH₄, a greenhouse gas with ~25× the warming potential of CO₂ |
| Biogas Production | Understanding methanogen physiology can improve bioenergy technologies |
| Carbon Cycling | Key microbes in anaerobic degradation of organic matter in marine sediments |
| Wastewater Treatment | Contribute to anaerobic digestion processes in engineered systems |
| Microbial Ecology | Important members of anaerobic microbial communities |
Membrane proteins like Memar_2039 may play critical roles in the methanogenic metabolism of these organisms, potentially involving energy conservation, substrate uptake, or environmental sensing . Understanding these proteins could lead to improved models of global methane cycling and enhanced biotechnological applications.
Based on genomic context and the physiological requirements of M. marisnigri, several hypotheses regarding the function of Memar_2039 can be proposed:
Energy conservation: May participate in the unique bioenergetic processes of methanogens
Membrane transport: Could function in the uptake of essential nutrients or export of metabolic products
Environmental sensing: Might be involved in detecting changes in redox conditions or other environmental parameters
Structural role: May contribute to the unique archaeal cell envelope architecture
The genome of M. marisnigri contains several distinctive features, including the presence of both Eha and Ech membrane-bound hydrogenases, suggesting a complex membrane protein complement involved in energy metabolism . Understanding the role of Memar_2039 within this context could provide insights into the adaptations of methanogens to anaerobic environments.
Recent technological advances are transforming our ability to study archaeal membrane proteins:
| Technology | Application to Memar_2039 Research |
|---|---|
| Single-particle cryo-EM | Enables structural determination without crystallization |
| Native mass spectrometry | Can analyze intact membrane protein complexes |
| Nanodiscs technology | Provides native-like membrane environment for functional studies |
| CRISPR-based tools | Emerging genetic systems for archaea enable precise functional studies |
| Computational methods | Improved prediction of structure, function, and evolutionary relationships |
These advanced techniques can overcome traditional challenges in membrane protein research and could provide unprecedented insights into the structure and function of proteins like Memar_2039.
Several promising research directions could advance our understanding of Memar_2039:
Comparative genomics across archaeal lineages to identify conserved features and evolutionary patterns
Integrated multi-omics approaches to correlate expression with environmental conditions
Structural biology studies to determine membrane topology and potential binding sites
Systems biology approaches to place Memar_2039 in the context of methanogenic metabolism
Evolutionary studies to understand the relationship between archaeal membrane proteins and those in bacteria and eukaryotes
These approaches could not only reveal the specific function of Memar_2039 but also contribute to our broader understanding of archaeal physiology and the evolution of membrane proteins across the domains of life.