Recombinant Methanoculleus marisnigri UPF0290 protein Memar_1002 (Memar_1002)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Gene Name: Memar_1002 (Ordered Locus Name)
Synonyms: carS (CDP-archaeol synthase)
Organism: Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Recombinant Production:

  • Expression Systems: Yeast (Saccharomyces cerevisiae) or Escherichia coli

  • Tag: Determined during production (commonly His-tag or GST-tag)

  • Purity: Optimized via affinity chromatography

Functional Role

Memar_1002 is annotated as CDP-archaeol synthase, an enzyme critical for synthesizing ether lipids unique to archaeal membranes . Key functional insights:

  • Catalyzes the transfer of geranylgeranyl groups to CDP-archaeol precursors.

  • Essential for membrane stability in extreme environments.

Enzymatic Activity:

SubstrateProductRole in Archaeal Metabolism
CDP-archaeol precursorsCDP-2,3-bis-O-geranylgeranyl-sn-glycerolEther lipid biosynthesis

Production and Purification

Expression Systems:

SystemAdvantagesLimitations
YeastEukaryotic post-translational modificationsLower yield compared to E. coli
E. coliHigh yield, cost-effectiveLack of archaeal-specific modifications

Research Applications

  • Biochemical Studies: Used to characterize ether lipid biosynthesis pathways in archaea .

  • Structural Biology: Partial sequence aids in homology modeling of full-length CDP-archaeol synthases .

  • Biotechnological Potential: Insights into lipid engineering for synthetic biology applications.

Genomic and Evolutionary Context

  • Genomic Location: Part of the M. marisnigri JR1 genome (GenBank: CP000562) .

  • Phylogenetic Significance: Shares homology with lipid synthases in other Methanoculleus species (e.g., M. bourgensis) .

Current Research Gaps

  • Full-Length Structure: The recombinant protein is partial; full-length expression and crystallization are pending .

  • Mechanistic Details: Kinetic parameters and regulatory mechanisms remain uncharacterized .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Please note that all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
carS; Memar_1002; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Target Names
carS
Target Protein Sequence
MIPAYVPNSAAALFGGGTPIDLGRTFSDGRRVFGDGKTYRGFFGGVVSGVLVGLIEIWAA TAFSLSALPQQTFLSVTLLATGALLGDLAKSFLKRRLGKDRGESWFLADQYDLVVGSFLL ILIFDPQWLFGTITLPIAVWIVVMTPLLHRVVNIIGYYIGVKEVPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanoculleus marisnigri and why is it of scientific interest?

Methanoculleus marisnigri is a methanogen belonging to the order Methanomicrobiales within the archaeal phylum Euryarchaeota. The type strain, JR1, was isolated from anoxic sediments of the Black Sea. This organism is of significant phylogenetic interest as it represents an important branch in archaeal taxonomy that was previously underrepresented in genome sequencing projects . As a mesophilic methanogen, it contributes to our understanding of methanogenesis in moderate temperature environments and offers insights into archaeal biochemistry and evolution.

How does the genome organization of Methanoculleus marisnigri compare to other methanogens?

Methanoculleus marisnigri's complete genome has been sequenced as part of the Joint Genome Institute's 2006 Community Sequencing Program to enhance our understanding of diverse Archaea . The genome analysis reveals adaptations specific to its anaerobic methanogenic lifestyle. Unlike some other methanogens, M. marisnigri has genomic features that reflect its adaptation to mesophilic environments rather than extreme conditions. Comparative genomic analyses show conservation of core methanogenesis pathways while displaying unique genomic elements that distinguish it from thermophilic and halophilic methanogens.

What expression systems are most effective for producing recombinant archaeal proteins like Memar_1002?

For archaeal proteins like Memar_1002, the selection of an appropriate expression system is critical. While bacterial systems (particularly Escherichia coli) offer simplicity and high yields, they often struggle with proper folding of archaeal proteins due to differences in cellular machinery. For functional studies, expression in yeast systems (S. cerevisiae or P. pastoris) often provides better results as they offer more sophisticated post-translational modification capabilities. For comprehensive structural and functional analyses, mammalian cell expression systems may be necessary, particularly when investigating glycosylation patterns . When expressing Memar_1002 specifically, researchers should consider:

  • Codon optimization for the host expression system

  • Addition of solubility-enhancing tags (MBP, SUMO, etc.)

  • Growth at reduced temperatures (15-25°C) to aid proper folding

  • Supplementation with archaeal-specific chaperones when available

What purification strategy yields the highest purity and activity of recombinant Memar_1002?

A multi-step purification approach is recommended for obtaining high-purity, active Memar_1002. Based on general archaeal protein purification protocols and the predicted properties of UPF0290 family proteins, the following strategy is advised:

  • Initial capture using affinity chromatography (typically His-tag or GST-tag)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

Throughout purification, it's critical to maintain anaerobic conditions when possible, as many archaeal proteins from methanogens are oxygen-sensitive. Buffer composition should include stabilizing agents such as glycerol (10-15%) and potentially reducing agents like DTT or β-mercaptoethanol to maintain protein integrity. Purification success can be monitored via SDS-PAGE, Western blotting, and activity assays developed specifically for the protein's predicted function.

How can researchers assess the proper folding and stability of purified Memar_1002?

To verify proper folding and stability of purified Memar_1002, researchers should employ multiple biophysical techniques:

  • Circular Dichroism (CD) spectroscopy to analyze secondary structure

  • Thermal shift assays to determine stability under various conditions

  • Dynamic Light Scattering (DLS) to assess homogeneity and aggregation state

  • Limited proteolysis to evaluate structural integrity

  • NMR or X-ray crystallography for detailed structural analysis

Additionally, functional assays based on predicted activities should be developed. For uncharacterized proteins like Memar_1002, initial functional hypotheses can be derived from structural similarities to characterized proteins or from genomic context analysis.

What is known about glycosylation patterns in Methanoculleus marisnigri proteins?

Specific N-glycan structures identified in M. marisnigri include:

  • A trisaccharide: α-GlcNAc-4-β-GlcNAc3NGaAN-4-β-Glc-Asn (where the second residue is 2-N-acetyl, 3-N-glyceryl-glucosamide)

  • A disaccharide: β-GlcNAc3NAcAN-4-β-Glc-Asn (where the terminal residue is 2,3 di-N-acetyl-glucosamide)

O-glycosylation has been observed in the threonine-rich region near the C-terminus of the S-layer protein, composed exclusively of hexoses .

How might glycosylation affect the structure and function of Memar_1002?

If Memar_1002 undergoes glycosylation, it could significantly impact its structure and function. Based on glycosylation patterns observed in other M. marisnigri proteins , potential effects include:

  • Enhanced protein stability and protection from proteolytic degradation

  • Altered solubility and surface properties

  • Modified protein-protein interactions

  • Potential roles in cellular localization, particularly if Memar_1002 associates with cell membrane components

Researchers investigating Memar_1002 should consider analyzing potential glycosylation sites using prediction algorithms and verify the presence of glycans experimentally using glycan-specific staining, mass spectrometry, or NMR analysis. Expression systems chosen for recombinant production should account for the organism's native glycosylation capabilities if these modifications prove essential for function.

What analytical techniques are most effective for characterizing post-translational modifications in archaeal proteins like Memar_1002?

For comprehensive characterization of post-translational modifications in archaeal proteins like Memar_1002, researchers should employ multiple complementary techniques:

  • Mass Spectrometry Approaches:

    • LC-MS/MS with electron transfer dissociation (ETD) for glycan analysis

    • MALDI-TOF MS for intact mass determination

    • Top-down proteomics for comprehensive PTM mapping

  • NMR Spectroscopy:

    • For detailed structural characterization of isolated glycans

    • To determine the precise linkages and configurations within complex modifications

  • Glycan-Specific Methods:

    • Periodic acid-Schiff (PAS) staining for initial detection

    • Lectin affinity approaches for glycan class identification

    • Glycosidase treatments combined with mobility shift assays

A combined analytical workflow has proven most effective, as demonstrated in the characterization of M. marisnigri glycans where both NMR and MS analyses were necessary to fully elucidate the structures .

What computational approaches can predict potential functions of uncharacterized proteins like Memar_1002?

For uncharacterized proteins like Memar_1002, computational approaches offer valuable insights into potential functions:

  • Sequence-Based Methods:

    • BLAST searches against characterized protein databases

    • Multiple sequence alignments with homologous proteins

    • Motif and domain analysis using InterPro, Pfam, and PROSITE

    • Detection of conserved residues that may indicate functional sites

  • Structure-Based Predictions:

    • Homology modeling based on structurally characterized proteins

    • Threading approaches when homology is limited

    • Ab initio modeling for novel fold prediction

    • Molecular dynamics simulations to predict flexibility and potential binding sites

  • Genomic Context Analysis:

    • Gene neighborhood examination for functional associations

    • Co-expression pattern analysis

    • Phylogenetic profiling to identify co-evolving genes

  • Integration of Multiple Data Types:

    • Network-based function prediction incorporating protein-protein interaction data

    • Metabolic pathway analysis for context-based functional inference

    • Machine learning approaches integrating diverse features

These computational predictions should guide the design of targeted experimental approaches rather than being considered definitive functional assignments.

What experimental approaches are recommended for determining the biological role of Memar_1002?

To experimentally determine the biological role of Memar_1002, researchers should implement a multi-faceted approach:

  • Genetic Manipulation Strategies:

    • Gene knockout or knockdown studies to observe phenotypic effects

    • Complementation experiments to confirm gene-phenotype relationships

    • Overexpression studies to identify potential gain-of-function effects

    • Site-directed mutagenesis of predicted functional residues

  • Protein Interaction Studies:

    • Pull-down assays to identify binding partners

    • Bacterial/yeast two-hybrid screens for interaction mapping

    • Co-immunoprecipitation from native sources when possible

    • Cross-linking coupled with mass spectrometry for interaction interfaces

  • Biochemical Activity Assays:

    • Testing predicted enzymatic activities based on computational analysis

    • Substrate screening using compound libraries

    • Activity-based protein profiling

  • Localization Studies:

    • Immunolocalization in native cells if antibodies are available

    • Fluorescent protein fusions for in vivo tracking

    • Subcellular fractionation coupled with western blotting

For archaeal systems like M. marisnigri, genetic manipulation may present challenges, making heterologous expression systems and in vitro approaches particularly valuable initial strategies.

How can researchers develop reliable activity assays for proteins of unknown function like Memar_1002?

Developing activity assays for uncharacterized proteins requires a systematic approach:

  • Hypothesis Generation:

    • Review computational predictions of potential functions

    • Examine genomic context for clues to metabolic role

    • Consider phylogenetic distribution and environmental niche requirements

  • Preliminary Screening:

    • Substrate panels based on predicted functional class

    • Generic activity assays for common enzymatic activities (kinase, phosphatase, etc.)

    • Thermal shift assays with potential substrates/cofactors to identify binding

  • Assay Development:

    • Direct measurement of substrate transformation when possible

    • Coupled enzyme assays for detecting products

    • Fluorescent or colorimetric reporter systems for high-throughput screening

    • Label-free techniques like isothermal titration calorimetry for binding interactions

  • Validation:

    • Negative controls using denatured protein or active site mutants

    • Dose-response relationships to confirm specificity

    • Kinetic characterization to establish catalytic parameters

    • Comparison with related proteins when available

For Memar_1002 specifically, initial assays might explore potential roles in methanogenesis pathways, stress responses common to archaea, or protein-protein interactions within archaeal-specific cellular processes.

How can structural biology approaches enhance our understanding of UPF0290 family proteins like Memar_1002?

Structural biology techniques can provide critical insights into UPF0290 family proteins:

  • X-ray Crystallography Benefits:

    • High-resolution structural details (potentially sub-2Å)

    • Identification of binding pockets and active sites

    • Co-crystallization with potential substrates or binding partners

    • Visualization of archaeal-specific structural features

  • Cryo-EM Advantages:

    • Structure determination without crystallization

    • Visualization of flexible regions often missed in crystal structures

    • Potential for capturing multiple conformational states

    • Analysis of larger protein complexes involving Memar_1002

  • NMR Spectroscopy Applications:

    • Dynamic studies revealing protein motion

    • Direct observation of substrate binding events

    • Characterization of intrinsically disordered regions

    • Solution structure determination under near-native conditions

  • Integrated Structural Biology Workflow:

    • Combining multiple techniques for comprehensive structural characterization

    • Computational modeling guided by experimental constraints

    • Evolutionary analysis mapped onto structural features

These approaches can reveal molecular mechanisms underlying Memar_1002 function and provide templates for structure-based drug design targeting related proteins in pathogenic archaea.

What are the challenges and solutions in expressing archaeal membrane proteins in heterologous systems?

Expressing archaeal membrane proteins like Memar_1002 (if it is membrane-associated) presents specific challenges:

  • Common Challenges:

    • Membrane composition differences between archaea and expression hosts

    • Toxicity to host cells during overexpression

    • Improper folding leading to inclusion body formation

    • Insufficient membrane insertion machinery compatibility

  • Optimized Solutions:

    • Modified expression vectors with tunable promoters to control expression levels

    • Fusion with membrane protein expression tags (e.g., Mistic, SUMO)

    • Co-expression with archaeal-specific chaperones when available

    • Use of specialized host strains with enhanced membrane protein expression capabilities

    • Expression at reduced temperatures (18-25°C) to allow proper folding

    • Addition of specific lipids to growth media to mimic archaeal membrane environments

  • Alternative Approaches:

    • Cell-free expression systems supplemented with archaeal lipids

    • Nanodiscs or lipid cubic phase systems for stabilization

    • Expression of minimal functional domains when full-length protein proves challenging

Successful expression typically requires empirical optimization of multiple parameters simultaneously, often necessitating high-throughput screening of expression conditions.

How can researchers leverage comparative genomics to understand the evolution of UPF0290 proteins across archaeal species?

Comparative genomics offers powerful approaches to understanding UPF0290 protein evolution:

  • Phylogenetic Analysis Methods:

    • Construction of comprehensive phylogenetic trees using maximum likelihood or Bayesian approaches

    • Identification of orthologous and paralogous relationships

    • Mapping of gene duplication and loss events across archaeal lineages

    • Detection of horizontal gene transfer events

  • Sequence Conservation Patterns:

    • Identification of universally conserved residues suggesting functional importance

    • Detection of lineage-specific conservation patterns reflecting specialized adaptations

    • Analysis of selection pressure (dN/dS ratios) to identify positions under purifying or positive selection

    • Correlation of conservation patterns with structural features

  • Genomic Context Analysis:

    • Examination of operon structure conservation across species

    • Identification of gene neighborhood patterns suggesting functional associations

    • Detection of synteny breaks indicating evolutionary rearrangements

  • Integration with Environmental Data:

    • Correlation of protein features with habitat-specific adaptations

    • Analysis of metagenome data to identify environmental distribution patterns

    • Study of gene presence/absence patterns in relation to metabolic capabilities

This comparative approach can reveal how UPF0290 proteins have adapted to diverse archaeal lifestyles and provide insights into their functional importance in different ecological niches.

What potential biotechnological applications exist for archaeal proteins like Memar_1002?

Archaeal proteins like Memar_1002 hold promise for various biotechnological applications:

  • Biocatalysis Applications:

    • Development of enzymes stable under extreme conditions

    • Novel catalytic activities for industrial bioprocesses

    • Bioremediation of contaminated environments

    • Green chemistry applications requiring unique reaction specificities

  • Biomaterials Development:

    • Self-assembling protein scaffolds based on archaeal S-layer proteins

    • Temperature-resistant biomaterials incorporating archaeal protein stability features

    • Novel bioconjugation approaches utilizing archaeal post-translational modifications

  • Biomedical Applications:

    • Vaccine development using archaeal proteins as carriers or adjuvants

    • Diagnostic tools leveraging unique archaeal protein properties

    • Drug delivery systems based on archaeal protein structures

  • Research Tools:

    • Development of archaeal expression systems for difficult-to-express proteins

    • Archaeal glycosylation machinery for production of specialized glycoproteins

    • Novel molecular biology tools derived from archaeal cellular processes

The unique evolutionary position of archaea provides a rich source of proteins with properties distinct from those found in bacteria or eukaryotes, offering opportunities for innovative biotechnological applications.

How might studying Memar_1002 contribute to our understanding of methanogenesis and climate change?

Research on Memar_1002 and other M. marisnigri proteins has implications for understanding methanogenesis and climate change:

  • Methanogenesis Process Insights:

    • Potential involvement in key steps of methane production

    • Identification of novel regulatory mechanisms in methanogenic pathways

    • Understanding adaptation of methanogenesis to different environmental conditions

  • Climate Change Relevance:

    • Methane is a potent greenhouse gas with 28-36 times the global warming potential of CO₂

    • Understanding methanogen biology is crucial for modeling methane emissions

    • Potential development of inhibitors targeting key methanogenesis proteins

    • Insights for methane mitigation strategies in agricultural and waste management settings

  • Research Directions:

    • Investigation of Memar_1002 expression under different environmental conditions

    • Metabolic flux analysis in the presence and absence of functional Memar_1002

    • Community interaction studies examining M. marisnigri in environmental consortia

    • Development of bioinformatics tools to predict methanogenesis rates based on protein expression patterns

By elucidating the roles of specific proteins in methanogenic archaea, researchers can better understand and potentially manipulate methane production processes with significant environmental implications.

What are the most promising directions for future research on M. marisnigri proteins?

Future research on M. marisnigri proteins, including Memar_1002, should focus on several promising directions:

  • Systems Biology Approaches:

    • Multi-omics integration (proteomics, transcriptomics, metabolomics)

    • Network modeling of protein interactions and pathway regulation

    • Machine learning applications for predicting protein function from complex datasets

    • Development of archaeal-specific systems biology tools

  • Structural Genomics Initiatives:

    • High-throughput structure determination of uncharacterized proteins

    • Mapping of protein interaction networks through structural biology

    • Development of archaeal protein structure databases

    • Integration of structural data with functional genomics

  • Ecological and Environmental Studies:

    • In situ studies of protein expression in natural environments

    • Metaproteomics to understand community-level protein functions

    • Climate change impact studies on methanogen protein expression

    • Biogeochemical cycling research incorporating protein-level insights

  • Synthetic Biology Applications:

    • Engineering of synthetic pathways incorporating archaeal proteins

    • Development of archaeal chassis organisms for specialized applications

    • Creation of minimal archaeal genomes to understand core functions

    • Design of hybrid bacterial-archaeal systems with novel capabilities

These future directions leverage emerging technologies and cross-disciplinary approaches to advance our understanding of archaeal proteins beyond traditional biochemical characterization.

What strategies can overcome solubility issues when working with recombinant archaeal proteins?

Addressing solubility challenges with archaeal proteins requires a multifaceted approach:

  • Expression Optimization:

    • Reduced induction temperature (16-20°C)

    • Lower inducer concentrations for slower protein production

    • Co-expression with archaeal or universal chaperones

    • Use of specialized strains designed for difficult proteins (e.g., C41(DE3), C43(DE3))

  • Fusion Partners and Tags:

    • Solubility-enhancing fusion partners (MBP, SUMO, GST, TrxA)

    • Optimized tag placement (N-terminal versus C-terminal)

    • Precise design of linker regions between protein and tags

    • Consideration of tag removal strategies that preserve solubility

  • Buffer Optimization:

    • Screening of pH ranges appropriate for archaeal proteins

    • Addition of stabilizing compounds (glycerol, arginine, proline)

    • Use of mild detergents or amphipathic compounds

    • Inclusion of specific cofactors or ligands that promote folding

  • Refolding Strategies:

    • On-column refolding protocols with decreasing denaturant gradients

    • Pulsed refolding with cyclic pressure treatment

    • Chaperone-assisted refolding systems

    • Dialysis-based refolding with additives to prevent aggregation

Systematic screening of these approaches through parallel small-scale experiments often yields conditions that significantly improve solubility of challenging archaeal proteins.

How can researchers troubleshoot inconsistent activity in purified recombinant Memar_1002?

When facing inconsistent activity with purified Memar_1002, consider these troubleshooting steps:

  • Protein Integrity Assessment:

    • SDS-PAGE under non-reducing and reducing conditions to verify disulfide status

    • Mass spectrometry to confirm full-length protein and identify modifications

    • Circular dichroism to verify consistent secondary structure between preparations

    • Dynamic light scattering to detect aggregation or oligomerization differences

  • Buffer and Storage Optimization:

    • Testing of multiple buffer compositions with varying pH and ionic strength

    • Addition of stabilizing agents (glycerol, trehalose, BSA)

    • Evaluation of different storage conditions (temperature, concentration)

    • Testing for activity loss over time under various storage conditions

  • Cofactor and Metal Ion Requirements:

    • Screening with common enzymatic cofactors (NAD+/NADH, FAD, etc.)

    • Addition of divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)

    • Dialysis against chelating agents followed by metal reconstitution

    • Assessment of potential redox sensitivity and anaerobic requirements

  • Post-translational Modification Considerations:

    • Evaluation of glycosylation status between preparations

    • Testing for phosphorylation or other modifications

    • Comparison of protein expressed in different systems with varying PTM capabilities

    • Enzymatic removal or addition of specific modifications to test their impact

Systematic documentation of purification conditions, storage history, and activity measurements is essential for identifying variables affecting protein activity.

What quality control metrics should be applied to ensure reproducible results when working with Memar_1002?

Implementing rigorous quality control is essential for reproducible research with Memar_1002:

  • Protein Quality Metrics:

    • Purity assessment via SDS-PAGE, SEC-MALS, and mass spectrometry

    • Identity confirmation through peptide mass fingerprinting

    • Homogeneity verification via analytical size exclusion chromatography

    • Stability analysis using thermal shift assays and accelerated stability testing

  • Activity Standardization:

    • Development of standard operating procedures (SOPs) for activity assays

    • Establishment of internal reference standards

    • Regular calibration of equipment used in activity measurements

    • Statistical process control charts to monitor assay performance over time

  • Documentation Requirements:

    • Detailed recording of expression conditions, purification methods, and buffer compositions

    • Batch record maintenance including chromatograms and quality analysis results

    • Use of electronic laboratory notebooks with standardized templates

    • Implementation of version control for protocols and analysis software

  • Reproducibility Testing:

    • Inter-batch comparison of key properties

    • Inter-laboratory validation when possible

    • Blinded analysis of duplicate samples to assess method robustness

    • Periodic replication of key experiments to verify consistency

  • Data Management:

    • Implementation of FAIR (Findable, Accessible, Interoperable, Reusable) data principles

    • Proper sample metadata recording

    • Use of standardized data formats and ontologies

    • Long-term archiving strategy for raw data

These quality control measures ensure that findings related to Memar_1002 are reliable and reproducible across different research settings and time periods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.