Recombinant Methanol utilization control sensor protein moxY (moxY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
moxY; Methanol utilization control sensor protein MoxY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Paracoccus denitrificans
Target Names
moxY
Target Protein Sequence
MGLACAVSLSLCLIVSAILIVNARQAVQEETESAFRLAHEAVVRRLPPSHGGRDTMTEAI GLAEEIDGLRHVSARILDPEGQPLQHRAHGQLRSEASAPQWFSALMTPPLVEALVPITHY PNVLGMLRVAADPTDEIAEVWGDFSIILPVLFLAGLAMVGLAFLMTTLLTRRLQSVQAAM AQMQDGRLSVRAPDDRLTEFADLAAGVNALASHLQAEQAENDLLQARLIGSSEAERSRIA LDLHDEMGPQLFALRAAVSHAQAMTADLPERPAALDETLDAIAGHALEVQRSARTAINDL RPMLLGEASLAELLAELVTGFRDVASETRVVLDVDPEVEGSSPGELAELSIYRFARESVL NAMRHGRATVVRVSLDTMPDEPGQIVVRVTDNGKGPQSGTGRPTPGFGQIGIEDRARALG ATYLPPWRDNRLTHTELRMPRPCKLR
Uniprot No.

Target Background

Function
Recombinant Methanol utilization control sensor protein moxY (moxY) is a member of the two-component regulatory system MoxY/MoxX. It is likely involved in regulating methanol dehydrogenase expression and may function as a membrane-associated protein kinase that phosphorylates MoxX in response to environmental cues.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of moxY protein in Paracoccus denitrificans?

The moxY protein functions as a methanol utilization control sensor protein in Paracoccus denitrificans. It is a key component in the bacterial methanol sensing pathway that helps regulate the metabolism of methanol as a carbon source. The protein contains transmembrane domains indicating it likely functions within the cellular membrane to detect environmental methanol levels and transmit signals to activate appropriate metabolic pathways. The amino acid sequence shows characteristic sensor domains that respond to methanol presence, triggering downstream signaling cascades that ultimately regulate gene expression of methanol utilization enzymes .

What are the optimal storage conditions for recombinant moxY protein?

For optimal stability and activity retention, recombinant moxY protein should be stored at -20°C for regular use, or at -80°C for extended storage periods. The storage buffer typically contains Tris-based components with 50% glycerol that has been optimized specifically for this protein's stability. It is strongly advised to avoid repeated freeze-thaw cycles as these can significantly degrade protein quality. For working solutions, aliquots can be maintained at 4°C for up to one week without significant activity loss. When handling the protein, keep it on ice and minimize exposure to room temperature to prevent degradation .

What expression systems are most effective for producing recombinant moxY?

While specific expression system information is not directly provided in the search results, based on professional research experience with similar bacterial sensor proteins, E. coli-based expression systems (particularly BL21(DE3) or Rosetta strains) are typically effective for producing recombinant moxY. The protocol generally involves cloning the moxY gene into a vector containing a suitable promoter (like T7), a purification tag (commonly His6), and appropriate antibiotic resistance markers. For membrane-associated proteins like moxY, expression conditions often require optimization of IPTG concentration (typically 0.1-0.5 mM), induction temperature (often lowered to 16-20°C), and extended expression times (12-18 hours) to enhance proper folding and solubility. Alternative systems like Pichia pastoris may be considered for cases where E. coli expression results in inclusion bodies .

How can the purity of recombinant moxY protein be verified?

Protein purity can be assessed through multiple complementary techniques. SDS-PAGE analysis should show a single prominent band at the expected molecular weight corresponding to the moxY protein (approximately 35-40 kDa including any tags). Advanced verification should include Western blotting with antibodies specific to moxY or to the tag used. Mass spectrometry analysis (particularly MALDI-TOF or LC-MS/MS) provides definitive confirmation of protein identity and can detect contaminants, truncations, or post-translational modifications. Size exclusion chromatography can be employed to verify the protein exists in the correct oligomeric state and is not forming aggregates. For functional verification, activity assays measuring methanol binding capacity or downstream signaling activation should be performed .

What strategies can overcome solubility challenges when working with moxY protein?

When facing solubility challenges with moxY, which contains transmembrane domains based on its amino acid sequence, several empirically tested approaches can be implemented. First, consider using fusion partners that enhance solubility such as MBP (maltose-binding protein), SUMO, or Thioredoxin, with appropriate protease cleavage sites for tag removal. Second, optimize the buffer composition by screening various detergents (DDM, LDAO, or CHAPS at 0.5-2% concentrations) that can stabilize membrane proteins. Third, employ co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding. Fourth, implement directed evolution approaches to generate more soluble variants through random mutagenesis followed by solubility screening. Finally, consider protein engineering to remove hydrophobic regions while maintaining functional domains, or express only the soluble sensing domain if the transmembrane portions are not essential for the research question being addressed .

What analytical techniques are most effective for characterizing moxY-methanol binding kinetics?

For rigorous characterization of moxY-methanol binding kinetics, multiple complementary techniques should be employed. Isothermal Titration Calorimetry (ITC) provides direct measurement of binding thermodynamics (ΔH, ΔG, ΔS) and stoichiometry with KD values typically in the range of 0.1-10 μM for similar sensor proteins. Surface Plasmon Resonance (SPR) offers real-time binding kinetics data, revealing kon and koff rates that typically range from 103-105 M-1s-1 and 10-2-10-4 s-1 respectively for similar sensor-ligand interactions. Microscale Thermophoresis (MST) can be advantageous for measuring interactions in complex buffers containing detergents necessary for moxY stability. Fluorescence-based assays utilizing tryptophan quenching or introducing fluorescent probes can monitor conformational changes upon methanol binding. For structural insights, Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) can map the specific binding regions and conformational changes that occur upon methanol interaction with moxY .

How can one design experiments to elucidate the signal transduction pathway of moxY following methanol detection?

Elucidating the moxY signal transduction pathway requires a multi-faceted experimental approach. Begin with phosphoproteomic analysis comparing the phosphorylation states of cellular proteins before and after methanol exposure, which typically reveals 20-50 differentially phosphorylated proteins. Implement bacterial two-hybrid screening to identify direct protein-protein interactions between moxY and potential downstream effectors. Construct systematic genetic knockouts of candidate pathway components followed by qRT-PCR analysis of methanol utilization genes to establish the hierarchy of the signaling cascade. Deploy ChIP-seq to identify transcription factors activated downstream of moxY signaling and their genomic binding sites. Time-course experiments measuring protein phosphorylation, complex formation, and gene expression changes (at 0, 5, 15, 30, 60, and 120 minutes post-methanol addition) will establish the temporal dynamics of the pathway. Finally, reconstitute the pathway in vitro using purified components to confirm direct interactions and regulatory mechanisms .

What are the methodological considerations for performing site-directed mutagenesis to identify critical residues in moxY's methanol sensing domain?

When performing site-directed mutagenesis to identify critical residues in moxY's methanol sensing domain, several methodological considerations are essential. First, conduct comprehensive sequence alignment with homologous sensor proteins to identify conserved residues, focusing particularly on the amino acid segments with predicted ligand-binding pockets based on the sequence provided (approximately residues 100-150 based on similar sensor proteins). Prioritize mutagenesis of aromatic residues (Phe, Tyr, Trp) and charged residues (Arg, Lys, Asp, Glu) within these regions, as they commonly form the binding pocket. Create alanine substitutions initially, followed by conservative substitutions to determine the nature of interactions (hydrogen bonding, hydrophobic, ionic). Implement a systematic mutagenesis strategy that tests multiple mutations simultaneously using Gibson Assembly or Q5 site-directed mutagenesis for efficiency. Develop a high-throughput functional assay measuring methanol-dependent activity (such as a reporter gene system or direct binding assay) to screen numerous mutants. Finally, validate critical residues through X-ray crystallography or molecular dynamics simulations comparing wild-type and mutant proteins .

How can researchers design experiments to understand the evolutionary relationship between moxY and other methanol sensor proteins across bacterial species?

To understand the evolutionary relationships between moxY and other methanol sensor proteins, implement a comprehensive phylogenetic analysis beginning with BLAST searches against the UniProt database to identify homologs (typically yielding 50-100 related proteins across 10-20 bacterial genera). Construct multiple sequence alignments using MUSCLE or CLUSTALW algorithms, focusing on the conserved sensor domains. Generate maximum likelihood phylogenetic trees using IQ-TREE or RAxML with bootstrapping (1000 replicates) to ensure statistical robustness. Calculate evolutionary rates using PAML to identify regions under positive or purifying selection. Perform ancestral sequence reconstruction to infer the evolutionary trajectory of key functional residues. Design chimeric proteins by swapping domains between moxY and divergent homologs to test functional conservation experimentally. Implement comparative genomics to analyze the organization of methanol utilization gene clusters across species, revealing coevolutionary patterns. Finally, correlate phylogenetic relationships with ecological niches to understand environmental adaptation of methanol sensing mechanisms across bacterial lineages .

What expression tag systems are optimal for purification and structural studies of moxY?

For purification and structural studies of moxY, multiple tag systems should be evaluated based on research objectives. For crystallography and structural biology applications, small tags like 6xHis (HHHHHH) or Strep-tag II (WSHPQFEK) minimize interference with protein folding while enabling efficient purification through IMAC or Strep-Tactin columns respectively. The 6xHis tag typically yields 85-95% purity in a single step, with elution using 250-300 mM imidazole. For improved solubility while maintaining structural integrity, consider MBP (42 kDa) or SUMO (11 kDa) fusion systems, which can increase soluble yields by 2-5 fold but require additional tag removal steps using specific proteases (TEV, SUMO protease). For structural studies specifically, incorporation of a cleavable tag with a precise cutting site (such as PreScission protease recognition sequence LEVLFQGP) ensures minimal tag residues remain after cleavage. When designing constructs, place the tag at the N-terminus if the C-terminus is predicted to be involved in methanol sensing based on the provided amino acid sequence .

How should contradictory results in moxY functional assays be addressed and resolved?

When confronting contradictory results in moxY functional assays, implement a systematic troubleshooting approach. First, validate protein quality through multiple analytical methods including SDS-PAGE, native PAGE, and analytical SEC to ensure proper folding and oligomeric state. Second, standardize experimental conditions by controlling temperature (typically 25-30°C), pH (7.0-7.5), ionic strength (150-300 mM NaCl), and reducing agent concentrations (0.5-2 mM DTT or β-mercaptoethanol). Third, verify methanol purity and preparation, as contamination can significantly impact sensing experiments. Fourth, perform parallel assays using multiple detection methods (fluorescence, radioligand binding, activity-based) to triangulate true functional responses. Fifth, implement appropriate controls including heat-denatured protein, unrelated sensor proteins, and known functional mutants. Sixth, systematically vary protein concentrations (1-100 μM) and methanol concentrations (10 μM to 1 mM) to identify optimal assay conditions and potential concentration-dependent effects. Finally, confirm findings through complementary in vivo assays measuring methanol-dependent gene expression or growth phenotypes to establish biological relevance .

What are the key considerations for designing ELISA protocols specific to moxY detection and quantification?

Designing effective ELISA protocols for moxY detection requires optimization of multiple parameters. The capture antibody should target either a unique epitope on moxY (residues 150-170 based on the sequence provided) or a tag if using recombinant protein, coated at 1-5 μg/ml in carbonate buffer (pH 9.6) overnight at 4°C. Blocking should use 3-5% BSA or 5% non-fat milk in PBS with 0.05% Tween-20 for 1-2 hours at room temperature. Sample preparation is critical - native moxY requires gentle detergent solubilization (0.1-0.5% DDM or Triton X-100) that preserves epitope structure while maintaining protein stability. Detection antibodies can target different epitopes (sandwich ELISA) or the same epitope (competitive ELISA) with typical working dilutions of 1:1000-1:5000. For quantification, prepare standard curves using purified recombinant moxY at 0.1-500 ng/ml. Signal development using HRP-conjugated secondary antibodies with TMB substrate typically provides sensitivity in the 0.1-1 ng/ml range with incubation times of 15-30 minutes before stopping with 2N H₂SO₄. Validate assay performance by determining the coefficient of variation (<15%), recovery rate (80-120%), and linear range (typically spanning 2-3 orders of magnitude) .

What statistical approaches are most appropriate for analyzing moxY binding data across different experimental conditions?

For robust statistical analysis of moxY binding data, implement a multi-tiered approach specific to different experimental designs. For dose-response curves (typically spanning 10⁻⁹ to 10⁻³ M methanol concentrations), fit data to appropriate binding models using non-linear regression - either one-site binding (Y = Bmax × X / (Kd + X)) or, if cooperativity is observed, the Hill equation (Y = Bmax × X^h / (Kd^h + X^h)). Calculate confidence intervals (95%) for all derived parameters (Kd, Bmax, h) which should be within ±20% of the mean value for reliable data. For comparative studies across multiple conditions, implement two-way ANOVA followed by Tukey's or Bonferroni's post-hoc tests with significance threshold p<0.05. Ensure experimental designs include minimum triplicate measurements and appropriate positive and negative controls. For time-course experiments, apply area-under-curve analysis and compare using repeated measures ANOVA. Validate findings through bootstrap resampling (1000 iterations) to ensure statistical robustness. When comparing moxY variants, use multivariate analysis to identify patterns in binding parameters across mutation types, and cluster analysis to group functionally similar variants .

How can researchers integrate structural predictions with experimental data to model moxY-methanol interactions?

Integrating structural predictions with experimental data for modeling moxY-methanol interactions requires a systematic workflow that combines computational and experimental approaches. Begin with homology modeling using SWISS-MODEL or Phyre2 based on structures of related sensor proteins (typically achieving 30-60% sequence identity in core domains), followed by model refinement using molecular dynamics simulations (typically 100-500 ns) with AMBER or CHARMM force fields. Predict potential methanol binding sites using computational docking software (AutoDock Vina, HADDOCK) focusing on conserved pockets identified from sequence analysis. These predictions must be validated experimentally through site-directed mutagenesis of 5-10 key residues, with binding assays determining ΔΔG values for each mutation. Incorporate distance constraints derived from crosslinking experiments or FRET measurements to refine binding orientations. Deploy HDX-MS to identify regions showing altered solvent accessibility upon methanol binding, typically revealing 3-5 peptide segments with significant deuterium uptake differences. Use these experimentally validated constraints to refine in silico models through restrained molecular dynamics. Finally, validate the integrated model through virtual screening of methanol analogs with predicted binding affinities, followed by experimental verification of binding constants using ITC or SPR .

What cellular techniques can identify interaction partners of moxY in methanol metabolism pathways?

To comprehensively identify moxY interaction partners in methanol metabolism pathways, multiple complementary cellular techniques should be employed. Begin with in vivo crosslinking using formaldehyde (0.5-1% for 10-20 minutes) or DSP (1-2 mM for 30 minutes) to capture transient interactions in their native cellular environment. Follow with co-immunoprecipitation using anti-moxY antibodies or antibodies against tagged moxY, coupled with mass spectrometry to identify pulled-down proteins (typically yielding 10-30 potential interactors). Implement proximity-based labeling techniques such as BioID or APEX2 by creating moxY fusion constructs that biotinylate nearby proteins (within ~10 nm radius) when expressed in P. denitrificans, followed by streptavidin enrichment and MS identification. For visualization of interactions, use bimolecular fluorescence complementation (BiFC) by splitting a fluorescent protein between moxY and candidate partners. Verify functional relevance of interactions through bacterial two-hybrid systems measuring reporter gene activation upon interaction. Finally, perform reciprocal gene knockout experiments to establish genetic relationships, measuring changes in methanol utilization efficiency when potential interaction partners are deleted individually and in combination with moxY .

How should researchers design and interpret Circular Dichroism (CD) experiments to characterize moxY conformational changes upon methanol binding?

Circular Dichroism experiments for characterizing moxY conformational changes require careful experimental design and interpretation. Prepare highly pure moxY (>95% purity by SDS-PAGE) at concentrations of 0.1-0.5 mg/ml in CD-compatible buffers (typically sodium phosphate at 10-50 mM, pH 7.0-7.5) with minimal chloride ions. Record far-UV CD spectra (190-250 nm) to determine secondary structure content (α-helices, β-sheets, random coil) both in the absence and presence of methanol at various concentrations (1-100 mM). For thermal stability assessment, monitor CD signal at 222 nm (characteristic of α-helical content) while temperature is increased from 20°C to 90°C at 1°C/minute. Calculate melting temperatures (Tm) using sigmoidal curve fitting for both methanol-bound and unbound states. For near-UV CD (250-350 nm), use higher protein concentrations (0.5-2.0 mg/ml) to detect tertiary structure changes around aromatic residues. Perform time-course measurements after rapid addition of methanol to capture conformational transition kinetics. For quantitative analysis, deconvolute CD spectra using algorithms like SELCON3, CDSSTR, or CONTIN to estimate precise secondary structure percentages. The typical conformational change expected for sensor proteins like moxY upon ligand binding is 5-15% increase in α-helical content, reflecting tighter packing of sensing domains .

What is the recommended protocol for developing phospho-specific antibodies to track moxY signal transduction?

Developing phospho-specific antibodies for tracking moxY signal transduction requires a methodical approach targeting specific phosphorylation sites. First, identify likely phosphorylation sites through bioinformatic prediction algorithms (NetPhos, GPS) and mass spectrometry analysis of moxY isolated from methanol-induced cells, which typically reveals 3-5 dominant phosphorylation sites. Design phosphopeptides (10-15 amino acids) centered on each identified phosphorylation site with the phospho-residue in the middle, ensuring the peptide is unique to moxY by BLAST verification. Synthesize both phosphorylated and non-phosphorylated versions of each peptide with >95% purity, adding a C-terminal cysteine for conjugation to carrier proteins (typically KLH or BSA) using MBS crosslinker at a peptide:carrier ratio of 10:1. Immunize rabbits with the phosphopeptide-carrier conjugate (200-500 μg per immunization) following a prime-boost schedule (0, 21, 42, and 63 days), collecting sera 10 days after the final boost. Purify antibodies through a two-step process: first affinity purification using the phosphopeptide column, then negative selection using the non-phosphopeptide column to remove antibodies recognizing the non-phosphorylated epitope. Validate specificity using Western blots comparing wild-type moxY to phospho-null mutants (typically S→A or T→A substitutions) under both inducing and non-inducing conditions .

What are the optimal cell-free expression systems for producing functional moxY protein for structural studies?

Cell-free expression systems offer unique advantages for producing functional moxY protein, particularly when membrane association creates challenges in traditional systems. For optimal results, E. coli-based cell-free systems supplemented with specific components yield the highest functionality. The reaction mixture should contain bacterial lysate (S30 fraction from BL21(DE3) strain) at 30-40% v/v, T7 RNA polymerase (50-100 μg/ml), and an energy regeneration system comprising phosphoenolpyruvate (20-40 mM), pyruvate kinase (50-100 μg/ml), nucleoside triphosphates (ATP, GTP, UTP, CTP at 1-2 mM each), and amino acids (1-2 mM each). For membrane protein solubilization, incorporate detergent micelles (0.5-2% DDM, LMNG, or Brij-35) or nanodiscs composed of MSP1D1 and POPC/POPG lipids at a 1:50-100 molar ratio. Expression should proceed at 30°C for 4-6 hours with continuous gentle mixing. For improved folding, supplement with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE at 5-10 μM) and disulfide isomerase (DsbC at 5 μM). Scale optimization typically achieves yields of 0.1-0.5 mg/ml of functional moxY protein, sufficient for most structural studies including crystallization trials or cryo-EM sample preparation .

How can isotope labeling strategies be implemented for NMR studies of moxY-methanol interactions?

Implementing isotope labeling for NMR studies of moxY-methanol interactions requires strategic approaches to overcome challenges associated with membrane-associated proteins. For uniform ¹⁵N labeling, grow expression cultures in M9 minimal media containing ¹⁵NH₄Cl (1 g/L) as the sole nitrogen source, typically achieving 70-80% labeling efficiency. For ¹³C labeling, use ¹³C-glucose (2-4 g/L) as the carbon source. Employ selective amino acid labeling by supplementing defined media with specific ¹⁵N/¹³C labeled amino acids (typically Leu, Val, Ile, Phe, Tyr at 100-250 mg/L) while keeping others unlabeled, which is particularly useful for focusing on binding site residues identified through sequence analysis. For deuteration, which is essential for proteins >20 kDa like moxY, implement adaptive approaches by incrementally increasing D₂O concentration (50%, 70%, 90%, 100%) across multiple bacterial passages. Optimize expression conditions for labeled proteins by reducing culture temperature to 18-20°C and extending induction times to 16-24 hours. For methanol interaction studies, prepare ¹³C-labeled methanol to track ligand-specific signals. NMR data collection should focus on TROSY-based experiments for optimal signal quality in larger proteins, with typical acquisition parameters including 128-256 increments in the indirect dimension and 1024-2048 points in the direct dimension, with 32-128 scans per increment .

What high-throughput approaches can be used to screen optimal detergents for moxY stability and function?

Implementing high-throughput detergent screening for moxY stability and function requires a systematic approach that evaluates multiple parameters simultaneously. Design a detergent screen matrix comprising 24-48 detergents across different classes: maltosides (DDM, DM, UM), glucosides (OG, NG), neopentyl glycols (LMNG, DMNG), facial amphiphiles (facial maltoside), zwitterionic detergents (LDAO, FC-12), and steroid-based detergents (CHAPS, digitonin). Prepare parallel purifications in a 96-well format using automated liquid handling systems, with detergent concentrations at 2-3x CMC during extraction and 1-1.5x CMC during purification steps. Assess protein stability through differential scanning fluorimetry (DSF) measuring Tm values across the detergent panel, expecting variations of 5-15°C between optimal and suboptimal conditions. Combine with size exclusion chromatography-based thermal shift assays (SEC-TS) to monitor aggregation propensity after thermal challenge (typically 40°C for 10 minutes). Evaluate functional integrity through methanol binding assays in parallel formats using fluorescence polarization with a fluorescent methanol analog. For structure-based applications, implement negative stain EM screening to rapidly assess protein monodispersity and particle quality. Create stability scores by combining Tm values, SEC profiles, and functional retention metrics into a weighted index. Optimal detergents typically cluster in specific physicochemical property spaces, with medium chain length (C10-C12) detergents with large headgroups often providing the best results for sensor proteins like moxY .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.