Recombinant Methanoplanus petrolearius Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
secD; Mpet_1696; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Methanolacinia petrolearia (strain DSM 11571 / OCM 486 / SEBR 4847) (Methanoplanus petrolearius)
Target Names
secD
Target Protein Sequence
MAEEKSTLGKIFTDWQVLIVLVLVILSVLSIYAIPPALDKGISGNLQLGLDLVGGSWIQL SFKSEVIGYESDMSQSDFITQLSEKLDADVIPVTSSSVEIREYYTKEELESVLAGMGAKL VTYEQGISKETADTVKGILEDKVNTLGTKDVQINTLTGANDVTKYVRVELAGTDINTAQE IVSSQGKFEIRIVTSGNETERVLSGDAVTSVSTPSQRNNYWGVGFTLSAEGAEALRDACI QYGAVTDPDSHNLVMLLDGEQVYSAPLSSDLAAKLSKGPVNDLSASTGYGEEGYNDAEVL EIHLRAGALPVDVEIAGSSSVTAERGEFIQIVCIAAAILGLLAVAFMVYYRYREPSIVVP MILVNLSEIIILLGIARYIQQLDLASIAGLIAVIGTGIDQLVVITDEVLHEGRVPSPSLY LKRFKRALGIITVSASTTIFAMLPLALMDLSTLKGFAIITILGVLIGVIFTRPAYGKIIM AILSKKPAK
Uniprot No.

Target Background

Function
Involved in protein export.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanoplanus petrolearius and why is it significant for protein translocase research?

Methanoplanus petrolearius is a disc-shaped methanogenic archaeon originally isolated from an African offshore oil field. The type strain SEBR 4847T (also designated as OCM 486) is non-motile with a G+C content of 50 mol% . This organism produces methane from H₂+CO₂, formate, and CO₂+propanol, and thrives in specific environmental conditions: optimal growth at 37°C (no growth observed at 25°C or 45°C), pH 7.0, and salt concentrations between 10-30 g/L NaCl (though it can tolerate up to 50 g/L) . Its doubling time is approximately 10 hours under optimal conditions.

M. petrolearius is particularly interesting for protein translocation studies because it represents an archaeal system that differs from the better-studied bacterial systems. The organism belongs to a distinct phylogenetic group, with analyses showing it appears as a sister group to Methanolacinia payntneri rather than clustering with other Methanoplanus species, suggesting the genus may be polyphyletic . This unique evolutionary position makes its protein translocation machinery of special interest for comparative studies across domains of life.

What is the function of SecD in protein translocation systems?

The SecD protein functions as part of a complex protein translocation machinery that facilitates the movement of proteins across cell membranes. While much of our understanding comes from bacterial systems rather than archaeal ones, the core principles likely apply to M. petrolearius SecD as well.

In bacterial systems, SecDF enhances protein translocation across the membrane, working in conjunction with the SecA ATPase and SecYEG complex . During protein translocation, SecDF undergoes conformational transitions that help pull precursor proteins from the SecYEG channel into the periplasm . Importantly, once SecDF captures a precursor protein on the periplasmic surface, it can complete protein translocation even when SecA function is inactivated by ATP depletion, indicating that SecDF acts as a protein-translocation motor that works independently of SecA .

Structural and functional analyses have demonstrated that SecDF utilizes the proton gradient across the membrane and interacts with precursor proteins in its flexible periplasmic region . This proton motive force-driven mechanism represents a distinct energy source from the ATP hydrolysis used by SecA, making SecDF an important component for efficient protein translocation.

How does SecD function within the complete protein translocation machinery?

In bacterial systems, SecD functions as part of an integrated translocation machinery with multiple subunits working in concert. While archaeal systems may differ in some aspects, the core mechanisms are likely conserved.

Functional studies reveal distinct but complementary roles for the various subunits:

Subunit/ComplexPrimary Functions
SecYEForms the translocation channel; provides high-affinity SecA binding sites; enables SecA activation
SecGFacilitates ATP-driven SecA membrane insertion/de-insertion; stimulates SecA insertion after initiation of translocation
SecDFyajCFacilitates and stabilizes SecA membrane insertion; supports SecYE-based translocation activity

Either SecG or SecDFyajC can support the translocation activity of SecYE by facilitating different stages of the ATP-driven cycle of SecA membrane insertion and de-insertion . This redundancy explains why SecDF depletion studies conducted in the presence of SecG showed only modest effects on translocation efficiency.

What experimental approaches are recommended for studying SecD function in archaeal systems?

Studying SecD function in archaeal systems like M. petrolearius requires specialized approaches that address both the unique properties of archaeal proteins and the technical challenges of working with membrane proteins:

  • Comparative genomic analysis: Bioinformatic comparison of SecD sequences across archaea, bacteria, and eukaryotes can identify conserved functional domains and lineage-specific adaptations. This should include phylogenetic analyses to understand evolutionary relationships, as Methanoplanus appears polyphyletic with M. petrolearius grouping with Methanolacinia payntneri .

  • Heterologous expression systems: Due to the challenging growth conditions of M. petrolearius (37°C, high salt, anaerobic ), heterologous expression in E. coli or yeast may facilitate protein production for functional studies. The recombinant protein should include appropriate tags for purification and detection while preserving functionality.

  • Reconstitution experiments: Purified SecD can be reconstituted into proteoliposomes along with other components of the translocation machinery to study its specific contribution to protein translocation. This approach allows for controlled manipulation of conditions like proton gradients and ATP availability.

  • Site-directed mutagenesis: Creating targeted mutations in conserved residues can help identify amino acids critical for SecD function, particularly those involved in proton gradient utilization, protein interactions, or conformational changes.

  • CRISPR-based genome editing: For in vivo studies, developing genetic tools for M. petrolearius would enable the creation of SecD variants or deletion mutants to assess the physiological impact of SecD modifications.

  • Cryo-electron microscopy: This technique can capture different conformational states of SecD during the translocation cycle, providing insights into the structural basis of its function within the complete translocase complex.

How do researchers address data contradictions when studying membrane proteins like SecD?

When studying complex membrane proteins like SecD, researchers often encounter contradictory data from different experimental approaches. Addressing these contradictions requires systematic analysis and experimental validation:

  • Recognize confirmation bias: Researchers may unconsciously interpret data to align with their expectations. Studies have shown that individuals with different expectations examining the same data plot can interpret it differently based on their preconceived notions . To counteract this, researchers should:

    • Employ blinded analysis where possible

    • Pre-register experimental hypotheses and analysis plans

    • Seek critical feedback from colleagues with different theoretical perspectives

  • Reconcile in vitro and in vivo discrepancies: Functional studies of SecDF initially showed discrepancies between in vivo and in vitro results. While in vivo studies suggested a stimulatory function for SecDF proteins, lack of evidence for in vitro stimulation led to hypotheses that SecDF might only act late in translocation . Later studies reconciled these contradictions by showing that SecDF directly supports in vitro ATP-driven translocation, but its effects are masked when SecG is present at saturating concentrations .

  • Consider protein complex interdependencies: When contradictory results arise regarding a protein's function, researchers should examine whether the protein's activity depends on interactions with other components. For example, the SecG-mediated stimulation of translocation occurs via SecYE, since overproduction of SecG without simultaneous overproduction of SecYE has no effect on preprotein translocation .

  • Validate with multiple methodologies: Cross-validation using complementary techniques can help resolve contradictions:

MethodologyStrengthsLimitations
Genetic studiesReveals physiological relevanceMay miss redundant functions
Biochemical assaysPrecise control of componentsMay not reflect in vivo complexity
Structural studiesReveals molecular mechanismsStatic snapshots may miss dynamics
Computational modelingIntegrates diverse dataRequires experimental validation

What are the optimal conditions for working with recombinant M. petrolearius SecD protein?

Based on the characteristics of M. petrolearius and general principles for handling membrane proteins, the following conditions are recommended for working with recombinant SecD:

Expression conditions:

  • Expression systems: E. coli strains specialized for membrane proteins (e.g., C41(DE3), C43(DE3))

  • Induction: Lower temperatures (16-20°C) and reduced inducer concentrations to prevent inclusion body formation

  • Growth media: Consider supplementation with specific lipids that may facilitate proper membrane protein folding

Purification considerations:

  • Detergent selection: Critical for maintaining protein stability and activity; test multiple detergents (DDM, LMNG, etc.)

  • Buffer conditions: Include stabilizing agents such as glycerol (typically 10-20%)

  • Storage: The recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

Reconstitution parameters:

  • Lipid composition: Consider mimicking archaeal membrane compositions, which differ significantly from bacterial membranes

  • Protein:lipid ratios: Optimize to ensure proper orientation and function in proteoliposomes

  • Buffer conditions: pH 7.0, with salt concentrations reflecting M. petrolearius optimal growth conditions (10-30 g/L NaCl)

What functional assays can assess SecD activity in translocation systems?

Several complementary assays can be employed to assess SecD function within protein translocation systems:

  • In vitro translocation assays: These measure the movement of radiolabeled or fluorescently labeled precursor proteins across membranes containing reconstituted translocation machinery. Key experimental variants include:

    • SecA-dependent vs. SecA-independent translocation to assess SecDF's ability to function independently of SecA

    • ATP-depleted conditions to isolate proton gradient-driven SecDF activity

    • Comparison of translocation efficiency with and without SecD to determine its contribution

  • Proton gradient coupling assays: Since SecDF utilizes the proton gradient , assays that measure proton movement coupled to protein translocation can provide insights into the energetics of SecD function. These may employ:

    • pH-sensitive fluorescent dyes to monitor proton movement

    • Ionophores that selectively dissipate proton gradients to confirm coupling

    • Mutational analysis of putative proton-conducting residues

  • Conformational change assays: SecDF undergoes conformational changes during protein translocation . These can be monitored using:

    • FRET (Förster Resonance Energy Transfer) between labeled domains

    • Crosslinking studies to capture interaction states

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Protein-protein interaction assays: To map the interactions between SecD and other components of the translocation machinery:

    • Co-immunoprecipitation with antibodies against specific components

    • Surface plasmon resonance to measure binding kinetics

    • Two-hybrid assays for in vivo interaction mapping

Assay TypeReadoutAdvantagesLimitations
In vitro translocationAppearance of protected fragmentsDirect functional measureTechnical complexity
Proton gradient couplingpH changes, ion movementsLinks energy to functionIndirect measure
Conformational changesFRET signals, crosslinking patternsReveals mechanismMay alter protein function
Protein-protein interactionsBinding partners, affinitiesMaps functional networkStatic rather than dynamic

How can researchers optimize expression of recombinant M. petrolearius SecD for structural studies?

Obtaining sufficient quantities of properly folded membrane proteins like SecD for structural studies presents significant challenges. Based on established approaches for membrane protein expression and purification, researchers should consider:

  • Expression system selection:

    • E. coli strains engineered for membrane protein expression (C41, C43, Lemo21)

    • Cell-free expression systems that can incorporate detergents or lipids during synthesis

    • Eukaryotic systems (yeast, insect cells) for proteins that misfold in prokaryotic hosts

    • Consider codon optimization based on the expression host, as archaeal coding preferences differ from those of expression hosts

  • Construct optimization:

    • Test multiple constructs with different boundaries to identify stable domains

    • Consider fusion partners that enhance expression and folding (e.g., GFP for monitoring, MBP for solubility)

    • Use fluorescence-detection size-exclusion chromatography (FSEC) to rapidly screen construct stability

    • Integration of purification tags that can be precisely removed (e.g., TEV protease sites)

  • Expression condition optimization:

    • Systematic screening of induction parameters (temperature, inducer concentration, time)

    • Modified growth media compositions (e.g., supplementation with specific metal ions, lipids)

    • Stress-response modifiers to improve folding (e.g., chaperone co-expression)

  • Purification strategy:

    • Multi-step purification protocols combining affinity, ion-exchange, and size-exclusion chromatography

    • Detergent screening and optimization, considering archaeal membrane specificity

    • Lipid supplementation during purification to maintain native-like environment

    • Stabilizing additives specific to SecD function (e.g., nucleotides, substrate peptides)

  • Stability assessment:

    • Thermal shift assays adapted for membrane proteins

    • Limited proteolysis to identify stable domains

    • Long-term stability monitoring at different temperatures

    • Assessment of oligomeric state by analytical ultracentrifugation or multi-angle light scattering

For cryo-electron microscopy studies specifically, reconstitution into nanodiscs or amphipols rather than detergent micelles may provide a more native-like environment and better contrast for imaging.

How should researchers interpret comparative analyses between bacterial and archaeal SecD proteins?

When comparing bacterial and archaeal SecD proteins, researchers must consider several factors that influence data interpretation:

Data TypeBacterial SecDArchaeal SecDIntegration Approach
Genetic studiesExtensive data on growth phenotypesLimited dataMap conservation of essential residues
Biochemical studiesWell-characterized interactionsEmerging dataFocus on conserved interaction partners
Structural studiesMultiple structures availableLimited structuresHomology modeling with experimental validation

In bacterial systems, SecDFyajC forms a heterotrimeric complex that associates with SecYEG to form the hexameric integral membrane domain of the preprotein translocase holoenzyme . When evaluating archaeal SecD, researchers should determine whether similar complexes form and function analogously or if archaeal systems have evolved distinct organizational principles.

What statistical approaches are appropriate for analyzing SecD functional data?

Functional studies of membrane proteins like SecD often generate complex datasets that require appropriate statistical treatments:

How can molecular dynamics simulations enhance understanding of SecD function?

Molecular dynamics (MD) simulations offer powerful approaches for studying membrane proteins like SecD, particularly when experimental data is limited:

  • Simulation setup considerations:

    • Membrane composition: Archaeal membranes differ significantly from bacterial ones; simulations should incorporate appropriate lipid compositions

    • System size optimization: Balance between computational cost and capturing relevant interactions

    • Force field selection: Validate results using multiple force fields to ensure robustness

    • Simulation timescales: Extended simulations may be needed to capture conformational changes

  • Key applications of MD for SecD research:

    • Conformational dynamics: Mapping potential conformational states and transitions

    • Proton transfer pathways: Identifying residues involved in proton conduction

    • Protein-substrate interactions: Characterizing binding interfaces and specificity determinants

    • Integration with experimental data: Using simulation to interpret limited experimental observations

  • Advanced simulation approaches:

    • Coarse-grained simulations: Enable longer timescales to observe large-scale conformational changes

    • Enhanced sampling techniques: Accelerate exploration of conformational space

    • QM/MM methods: Study proton transfer mechanisms with quantum mechanical accuracy

    • Markov state modeling: Extract kinetic and thermodynamic information from simulation trajectories

  • Integration with experimental data:

    • Validation against structural constraints from crosslinking or spectroscopic measurements

    • Refinement of homology models based on experimental accessibility data

    • Generation of testable hypotheses for experimental validation

    • Interpretation of functional effects of mutations

What are the emerging technologies for studying archaeal membrane proteins like SecD?

Several cutting-edge technologies are poised to advance our understanding of archaeal membrane proteins like SecD:

  • Single-molecule approaches:

    • Single-molecule FRET to observe conformational dynamics during protein translocation

    • Optical tweezers to measure forces involved in protein unfolding and translocation

    • Single-molecule tracking in native-like membrane environments

  • Advanced structural methodologies:

    • Time-resolved cryo-EM to capture transient conformational states

    • Integrative structural biology combining multiple data sources (cryo-EM, crosslinking MS, EPR)

    • Serial femtosecond crystallography at X-ray free-electron lasers for radiation-sensitive samples

  • Artificial intelligence applications:

    • Deep learning for improved structure prediction and functional annotation

    • Machine learning for optimizing expression and purification conditions

    • Network analysis to predict functional interactions in the complete translocation machinery

  • Synthetic biology approaches:

    • Minimal translocation systems assembled from defined components

    • Creation of chimeric systems combining components from different domains of life

    • Engineering archaeal expression systems optimized for membrane protein production

What are the unresolved questions about SecD function in archaea?

Despite advances in understanding protein translocation, several key questions remain about archaeal SecD function:

  • Energy coupling mechanisms:

    • How exactly does the proton gradient drive SecD-mediated translocation?

    • Are there archaeal-specific adaptations in the energy coupling mechanism?

    • How do extreme environmental conditions (high salt, high temperature) affect energy coupling?

  • Evolutionary considerations:

    • Given the polyphyletic nature of Methanoplanus , how has SecD function evolved across archaeal lineages?

    • What are the functional implications of the evolutionary relationship between M. petrolearius and Methanolacinia payntneri?

    • Are there lateral gene transfer events that have shaped archaeal translocation machinery?

  • Integration with unique archaeal cellular processes:

    • How does SecD function in the context of archaeal cell envelope structures?

    • Are there archaea-specific proteins that interact with SecD?

    • How do extremophilic archaea adapt their translocation machinery to extreme conditions?

  • Regulatory mechanisms:

    • How is SecD expression regulated in response to environmental changes?

    • Are there post-translational modifications that affect SecD function?

    • What quality control mechanisms ensure proper assembly of the translocation complex?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.