Recombinant Methanopyrus kandleri Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to CobS

Cobalamin synthase (CobS; EC 2.7.8.26) is a critical enzyme in the biosynthesis of cobalamin (vitamin B12), a cofactor essential for methanogenesis in archaea like Methanopyrus kandleri. Recombinant M. kandleri CobS refers to the enzyme produced through heterologous expression in organisms such as Escherichia coli, enabling biochemical and structural studies . CobS catalyzes the final step in cobalamin biosynthesis, attaching α-ribazole-5′-phosphate (α-RP) to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate (AdoCbl-P) . This step is conserved across archaea and bacteria but differs in enzyme specificity and pathway organization .

Genomic Context and Operon Structure

The cobS gene in M. kandleri is part of a conserved operon involved in corrinoid biosynthesis:

GeneAnnotationFunction
cbiSAdoCbi amidohydrolase/α-RP phosphataseSalvages cobinamide (Cbi) and processes α-RP
cobSCobalamin synthaseCondenses AdoCbi-GDP with α-RP to form AdoCbl-P
cobYGTP:AdoCbi-P guanylyltransferaseActivates AdoCbi-P for nucleotide loop assembly
Mk1669Hypothetical proteinUnknown role

This operon highlights the integration of salvaging and de novo pathways in archaeal cobalamin synthesis .

Enzymatic Function and Pathway Role

CobS operates in the nucleotide loop assembly phase:

  1. Substrates: Adenosylcobinamide-GDP (AdoCbi-GDP) and α-RP.

  2. Reaction: Catalyzes the condensation reaction to form AdoCbl-P, which is dephosphorylated by CobZ to yield active AdoCbl .

  3. Cofactor Specificity: Unlike bacterial systems, archaea use CobY (instead of CobU) for guanylylation, reflecting pathway divergence .

Key Biochemical Features:

  • Optimal Activity: Likely thermostable, consistent with M. kandleri’s hyperthermophilic nature (growth at 98°C) .

  • Dependence on CobY: CobY generates AdoCbi-GDP, the direct substrate for CobS .

Recombinant Production and Applications

Recombinant M. kandleri CobS has been produced for functional studies:

ParameterDetails
Expression HostEscherichia coli
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -80°C
ApplicationsWestern blot (WB), ELISA, enzymatic assays

The recombinant protein (UniProt ID: Q8TV85) comprises 397 amino acids, with a predicted molecular weight of ~45 kDa . Its thermostability makes it valuable for industrial biocatalysis and structural biology .

Evolutionary and Functional Significance

  • Role in Methanogenesis: CobS-generated AdoCbl is essential for methyltransferase enzymes in methane production .

  • Biotechnological Potential: Thermostable CobS could optimize B12 production in industrial settings .

Outstanding Questions:

  • Structural determinants of CobS substrate specificity.

  • Regulatory mechanisms governing operon expression in M. kandleri.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; MK1671; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Target Names
cobS
Target Protein Sequence
MIRVEFLKVFRFLTVLPIGEHPKSPREIGEQAWLGLPAVGLVSGLLAGVVAWAFAGTPVR GCLVVLTLLVLEGAQHFDGLVDVGDALMAGVISEEGATKAMRDPRVGVGGLAIGSMALLL AVASFGWIPFEVLVPIEVFSRFTVLPMAAVGEPAPASYSGRVFTEYVDADQVLLGGILST VVSLPFSPVATLTCAVCSAVVAWTCLEAARRTIRGVNGDFLGASIWVSRVLSAVCLSSLP W
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Methanopyrus kandleri* catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: mka:MK1671

STRING: 190192.MK1671

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanopyrus kandleri Cobalamin synthase (cobS) and what is its role in cobalamin biosynthesis?

Methanopyrus kandleri Cobalamin synthase (cobS) is a crucial enzyme in the final stages of cobalamin (vitamin B12) biosynthesis pathway. It functions as an adenosylcobinamide-GDP ribazoletransferase or cobalamin-5'-phosphate synthase that catalyzes one of the terminal reactions in the assembly of the complete cobalamin molecule. Specifically, cobS mediates the condensation of adenosylcobinamide-GDP with the lower ligand (typically 5,6-dimethylbenzimidazole) to form adenosyl-cobalamin 5′-phosphate, which upon dephosphorylation yields the biologically active coenzyme adenosylcobalamin .

This enzyme belongs to the Nucleotide Loop Assembly (NLA) pathway, which is responsible for attaching the nucleotide loop to the corrin ring structure. While cobalamin is utilized by organisms across all domains of life as an essential cofactor, de novo biosynthesis is restricted to certain bacteria and archaea, making cobS an interesting subject for understanding archaeal metabolism and evolution .

The enzyme's function in an extremophile like Methanopyrus kandleri is particularly significant as it must remain active under high temperature, high pressure conditions that would typically denature proteins from mesophilic organisms.

How does the cobS gene fit into the broader context of Methanopyrus genomics?

The cobS gene is part of the cobalamin biosynthetic pathway genes in Methanopyrus genomes. Comparative genomic analysis of Methanopyrus species has revealed insights into their evolutionary adaptation to extreme environments. Studies comparing Methanopyrus strains SNP6 and KOL6 (isolated from the Atlantic and Iceland, respectively) with M. kandleri AV19 have demonstrated genetic diversity and genomic plasticity that may contribute to their adaptation to different extreme habitats .

The presence of the cobalamin biosynthesis pathway in Methanopyrus is significant for several reasons:

  • It represents a metabolic capability that provides these organisms with autonomous production of this essential cofactor in nutrient-limited extreme environments.

  • The pathway may have unique adaptations that reflect the evolutionary history of this deeply-branching archaeal lineage.

  • Genomic analysis has identified a ~120-Kb genomic region of plasticity that impacts the architecture of various metabolic pathways, potentially including cobalamin biosynthesis .

The study of cobS in the context of Methanopyrus genomics contributes to our understanding of archaeal phylogenetic patterns and the biological significance of these extremophilic microbes. Furthermore, it provides insights into how essential metabolic pathways have been maintained and adapted in organisms inhabiting some of Earth's most extreme environments.

What expression systems are optimal for producing functional recombinant Methanopyrus kandleri cobS?

Based on available data, Escherichia coli has been successfully employed as an expression host for recombinant Methanopyrus kandleri cobS protein. The commercially available form is expressed as a full-length protein (241 amino acids) fused to an N-terminal histidine tag in E. coli . This indicates that despite the significant phylogenetic distance between E. coli (a mesophilic bacterium) and M. kandleri (a hyperthermophilic archaeon), functional heterologous expression is achievable.

For optimal expression of archaeal proteins like cobS in E. coli, researchers should consider the following methodological approaches:

  • Codon optimization: Adjusting the cobS gene sequence to match E. coli codon usage preferences can significantly improve expression levels by addressing translation inefficiencies.

  • Expression vector selection: Vectors with strong, inducible promoters (such as T7) and appropriate regulatory elements are preferable. The pET expression system is commonly used for recombinant archaeal proteins.

  • Host strain considerations: E. coli strains engineered to provide rare tRNAs (such as Rosetta or CodonPlus strains) or enhance disulfide bond formation (such as Origami strains) may improve expression outcomes.

  • Induction parameters optimization:

    • Temperature: Often lowered to 16-25°C during induction to improve protein folding

    • Inducer concentration: Typically IPTG at 0.1-1.0 mM

    • Induction time: Usually extended (16-24 hours) at lower temperatures

  • Fusion tags: The N-terminal His-tag used for M. kandleri cobS serves dual purposes of facilitating purification and potentially enhancing solubility.

When standard E. coli expression proves challenging, alternative expression systems such as archaeal hosts (e.g., Thermococcus kodakarensis or Sulfolobus species) might provide a more native-like environment for proper folding of archaeal proteins, though these systems are technically more demanding.

What purification strategies yield high-purity, active Methanopyrus kandleri cobS protein?

Purification of recombinant Methanopyrus kandleri cobS can be achieved through a multi-step process that leverages the N-terminal histidine tag and the inherent thermostability of this archaeal protein. Based on the available information and established methods for similar proteins, the following purification strategy is recommended:

  • Initial capture using Immobilized Metal Affinity Chromatography (IMAC):

    • Nickel or cobalt resins bind the His-tagged cobS protein

    • Washing with increasing imidazole concentrations (typically 20-50 mM) removes weakly bound contaminants

    • Elution with high imidazole concentration (250-500 mM) releases the target protein

  • Heat treatment (thermal purification step):

    • Exploiting the thermostability of M. kandleri proteins

    • Heating the IMAC-purified fraction to 65-80°C for 10-30 minutes

    • Centrifugation to remove heat-denatured E. coli proteins

    • This step significantly enhances purity with minimal loss of the thermostable cobS

  • Size exclusion chromatography:

    • Further purification based on molecular size

    • Also allows determination of the oligomeric state of the protein

    • Typically conducted in the final storage buffer

  • Final concentration and buffer exchange:

    • Ultrafiltration using appropriate molecular weight cut-off membranes

    • Exchange into storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

The purified protein can be maintained as a solution or lyophilized for longer-term storage. For the lyophilized product, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol for storage at -20°C/-80°C .

This purification approach typically yields protein with greater than 90% purity as determined by SDS-PAGE , which is sufficient for most biochemical and structural studies.

What are the critical factors for maintaining stability and activity of purified cobS?

Maintaining the stability and activity of purified Methanopyrus kandleri cobS requires careful attention to several critical factors:

  • Temperature management:

    • Avoid repeated freeze-thaw cycles, which significantly impact protein stability

    • Store working aliquots at 4°C for short-term use (up to one week)

    • For long-term storage, maintain at -20°C/-80°C in appropriate buffer conditions

  • Buffer composition optimization:

    • The recommended storage buffer contains Tris/PBS base with 6% Trehalose at pH 8.0

    • Trehalose acts as a protein stabilizer by preventing denaturation and aggregation

    • The neutral to slightly alkaline pH (8.0) helps maintain protein stability

  • Cryoprotectant addition:

    • Addition of glycerol to a final concentration of 5-50% is recommended for frozen storage

    • Glycerol prevents formation of ice crystals that can damage protein structure

  • Protein concentration considerations:

    • Recommended reconstitution to 0.1-1.0 mg/mL

    • Overly concentrated solutions may promote aggregation

    • Insufficient concentration may lead to adsorption losses to container surfaces

  • Storage container selection:

    • Low-protein binding materials (certain plastics or glass with siliconized surfaces)

    • Small volume aliquots to minimize freeze-thaw cycles

The enzyme's thermophilic nature suggests it may have greater inherent stability than mesophilic counterparts, but proper storage conditions remain essential for maintaining catalytic activity over time. Researchers should validate enzyme activity periodically, particularly after extended storage periods or when developing new experimental conditions.

For critical experiments, preparation of fresh enzyme or validation of activity using appropriate assays is recommended to ensure reliable and reproducible results.

How does the structure of Methanopyrus kandleri cobS compare with homologous enzymes in other organisms?

While direct structural information for Methanopyrus kandleri cobS is not provided in the search results, insights can be drawn from studies of related enzymes in the cobalamin biosynthesis pathway across different organisms. Structural studies of other archaeal cobalamin biosynthesis enzymes have revealed significant differences compared to their bacterial counterparts.

For example, studies of the archaeal phosphoribosyltransferase (CobT) from Methanocaldococcus jannaschii revealed distinct structural features compared to the bacterial homolog from Salmonella enterica:

  • Different catalytic residues: The archaeal enzyme utilizes an aspartate residue (Asp52) as the general base for catalysis, whereas the bacterial enzyme employs a glutamate residue (E317) .

  • Distinct quaternary structure: The dimer interface in the archaeal enzyme differs completely from that observed in the bacterial counterpart, suggesting different modes of subunit interaction and potentially different regulatory mechanisms .

These observations suggest that archaeal cobalamin biosynthesis enzymes, including cobS, may have evolved unique structural features that reflect:

  • Adaptation to extreme environments

  • Ancient evolutionary divergence between archaea and bacteria

  • Potentially different catalytic mechanisms or substrate specificities

A comprehensive structural comparison would require:

  • X-ray crystallography or cryo-electron microscopy studies of M. kandleri cobS

  • Structural alignment with homologous enzymes from other archaea and bacteria

  • Analysis of active site architecture and substrate binding pockets

  • Identification of features contributing to thermostability

Such comparative structural analyses would provide valuable insights into the evolution of cobalamin biosynthesis across domains of life and the structural adaptations that enable function in extreme environments.

What spectroscopic and biophysical methods are most effective for characterizing cobS activity and stability?

Multiple complementary spectroscopic and biophysical methods can be employed to thoroughly characterize the activity and stability of Methanopyrus kandleri cobS:

  • Enzyme activity assays:

    • HPLC-based assays monitoring the conversion of adenosylcobinamide-GDP to adenosyl-cobalamin 5′-phosphate

    • UV-visible spectroscopy leveraging the distinct absorption spectra of cobalamin compounds (typically monitoring around 361 nm and 550 nm)

    • Mass spectrometry to detect and quantify reaction products

    • Coupled enzymatic assays linking cobS activity to a spectrophotometrically detectable reaction

  • Thermal stability analysis:

    • Differential Scanning Calorimetry (DSC) to determine the melting temperature (Tm) and thermodynamic parameters of unfolding

    • Circular Dichroism (CD) thermal melts monitoring secondary structure changes during thermal denaturation

    • Thermofluor (differential scanning fluorimetry) assays using environment-sensitive fluorescent dyes

    • Activity assays at various temperatures to establish the temperature optimum and thermal stability profile

  • Structural integrity assessment:

    • Circular Dichroism spectroscopy to analyze secondary structure content

    • Tryptophan/tyrosine fluorescence spectroscopy to monitor tertiary structure

    • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS) to determine oligomeric state and molecular weight

    • Small-Angle X-ray Scattering (SAXS) for low-resolution structural information in solution

  • Ligand binding studies:

    • Isothermal Titration Calorimetry (ITC) to determine binding affinity and thermodynamic parameters

    • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) for binding kinetics

    • Microscale Thermophoresis (MST) for binding affinity determination with minimal protein consumption

  • Long-term stability monitoring:

    • Activity assays over time under various storage conditions

    • Size exclusion chromatography to detect aggregation during storage

    • SDS-PAGE to assess potential degradation

Because cobS originates from a hyperthermophile, these methods should be adapted to accommodate high-temperature conditions when appropriate. For instance, activity assays should be conducted at elevated temperatures (65-95°C) that better reflect the native environmental conditions of Methanopyrus kandleri.

What site-directed mutagenesis approaches can elucidate the catalytic mechanism of cobS?

Site-directed mutagenesis studies of Methanopyrus kandleri cobS can provide valuable insights into its catalytic mechanism. Based on knowledge of similar enzymes and general principles of enzyme catalysis, the following strategic approach to mutagenesis is recommended:

  • Identification of putative catalytic residues:

    • Acidic residues (Asp, Glu) that may act as general bases/acids

    • Basic residues (His, Lys, Arg) that may stabilize transition states or participate in proton transfers

    • Conservative residues identified through sequence alignment with homologous enzymes

    For example, if M. kandleri cobS follows the pattern observed in other archaeal cobalamin biosynthesis enzymes, aspartate residues might play key catalytic roles, as seen with the Asp52 in M. jannaschii CobT .

  • Targeted mutations to probe function:

    • Conservative mutations (e.g., Asp→Asn, Glu→Gln) to maintain size but remove charge

    • Charge reversal mutations (e.g., Asp→Lys) to drastically alter electrostatic properties

    • Size alterations (e.g., Asp→Ala) to create space or remove functionality

  • Substrate binding pocket mapping:

    • Mutations of residues predicted to interact with the adenosylcobinamide-GDP substrate

    • Alterations to residues likely involved in lower ligand binding

    • Modifications to residues potentially involved in proper orientation of substrates

  • Metal binding site investigation:

    • Mutation of histidine, cysteine, or acidic residues that might coordinate metal ions

    • Biochemical assays in the presence of various metal ions and chelators

  • Thermostability determinant analysis:

    • Mutations targeting residues unique to thermophilic cobS variants

    • Introduction of glycine residues to increase flexibility at key positions

    • Disruption of potential salt bridges or hydrogen bond networks

Recommended methodological approaches:

Mutagenesis TargetMutation TypesAnalysis Methods
Putative catalytic residuesAla, Asn/Gln substitutionsActivity assays, pH-rate profiles
Substrate binding residuesConservative and non-conservative substitutionsBinding assays, enzyme kinetics (Km)
Metal binding sitesHis→Ala, Cys→Ser, Asp→AsnActivity with/without metal supplementation
Thermostability determinantsIntroduction/removal of charged residuesThermal denaturation assays

Each mutant should be characterized for both structural integrity (to ensure mutations don't disrupt folding) and functional changes (activity, substrate binding, temperature dependency). This systematic approach can elucidate the roles of specific residues in catalysis, substrate recognition, and thermostability, providing a comprehensive understanding of the cobS catalytic mechanism.

How can Methanopyrus kandleri cobS serve as a model for understanding enzyme adaptation to extreme environments?

Methanopyrus kandleri cobS represents an excellent model system for investigating enzyme adaptation to extreme environments for several compelling reasons:

  • Evolutionary context: Methanopyrus kandleri occupies a deep-branching position in the archaeal domain, making its enzymes valuable for studying ancient adaptations to extreme conditions. The cobS enzyme provides insights into how essential metabolic pathways have evolved to function in harsh environments .

  • Thermostability mechanisms: As a protein from an organism that thrives at temperatures up to 110°C, cobS likely employs multiple structural adaptations for thermostability. Systematic analysis can reveal:

    • Increased electrostatic interactions (salt bridges)

    • Enhanced hydrophobic core packing

    • Strategic placement of proline residues

    • Reduced length and number of surface loops

    • Higher proportion of charged versus polar residues

  • Comparative analysis platform: Comparing M. kandleri cobS with homologous enzymes from mesophilic and thermophilic organisms allows researchers to distinguish between:

    • Features essential for catalytic function

    • Adaptations specifically related to thermostability

    • Ancestral vs. derived characteristics

  • Structure-function studies: Investigating how cobS maintains structural integrity and catalytic precision at temperatures that would denature most proteins provides insights applicable to protein engineering.

  • Extremophile metabolic integration: Understanding how cobS functions within the broader context of M. kandleri metabolism illuminates adaptations at both enzymatic and pathway levels .

Research approaches that leverage cobS as a model include:

Investigation AreaMethodologyExpected Insights
Thermal adaptationComparative structural analysis, thermal denaturation studiesSpecific structural features conferring thermostability
Catalytic efficiencyEnzyme kinetics at various temperatures, pressure conditionsTemperature dependence of catalysis, pressure effects
Protein flexibilityHydrogen-deuterium exchange, molecular dynamics simulationsBalance between rigidity for stability and flexibility for function
Evolutionary conservationPhylogenetic analysis, ancestral sequence reconstructionEvolutionary trajectory of adaptations to extreme environments

These studies contribute to our fundamental understanding of protein biophysics and provide principles that can be applied to the engineering of enzymes for biotechnological applications requiring stability under harsh conditions.

What insights can cobS provide into the evolution of cobalamin biosynthesis pathways?

Methanopyrus kandleri cobS offers a valuable window into the evolution of cobalamin biosynthesis pathways, particularly because it represents an enzyme from a deeply-branching archaeal lineage that inhabits extreme environments. Several key evolutionary insights can be derived from studying this enzyme:

  • Ancient nature of cobalamin biosynthesis: Cobalamin is one of the most complex cofactors synthesized in nature, and its biosynthesis pathway is believed to have ancient origins. The presence and characteristics of cobS in M. kandleri can provide insights into the ancestral features of this pathway .

  • Domain-specific adaptations: Comparative analysis of cobS from archaea, including M. kandleri, with bacterial homologs reveals domain-specific adaptations. As observed with other cobalamin biosynthesis enzymes, archaeal versions often employ different catalytic residues and quaternary structures compared to their bacterial counterparts .

  • Pathway variations across domains: Study of the complete cobalamin biosynthesis pathway in M. kandleri, including cobS, can reveal how this complex metabolic pathway has been conserved or modified across evolutionary time. Particularly interesting is how the pathway functions in extreme environments.

  • Horizontal gene transfer assessment: Analysis of cobS sequences across archaea can provide evidence for potential horizontal gene transfer events that shaped the evolution of cobalamin biosynthesis. Genomic context analysis of cobS in M. kandleri and related species can reveal gene cluster organization patterns reflecting evolutionary history .

  • Substrate specificity evolution: Investigation of cobS substrate preferences can indicate how the enzyme's specificity has evolved, potentially revealing transitions in lower ligand preferences across different lineages.

This research not only enhances our understanding of evolutionary biochemistry but also provides insights into the minimal and essential features required for cobalamin biosynthesis, which has implications for both fundamental science and biotechnological applications.

How can recombinant Methanopyrus kandleri cobS be utilized in biotechnological applications?

The recombinant Methanopyrus kandleri Cobalamin synthase (cobS) offers several promising biotechnological applications, leveraging its unique properties as an enzyme from a hyperthermophilic archaeon:

  • Thermostable biocatalyst for cobalamin derivative synthesis:

    • The exceptional thermostability of M. kandleri cobS enables biocatalytic reactions at elevated temperatures

    • High-temperature reactions can provide advantages including increased substrate solubility, reduced risk of microbial contamination, and potentially faster reaction rates

    • The enzyme could be employed in the synthesis of specialized cobalamin derivatives for research or therapeutic applications

  • Template for protein engineering:

    • The structural features conferring thermostability to M. kandleri cobS can serve as a blueprint for engineering other enzymes

    • Creation of chimeric enzymes incorporating thermostability-enhancing domains from cobS

    • Development of algorithms predicting stabilizing mutations based on patterns observed in cobS

  • Component in cell-free enzymatic cascades:

    • Integration into multi-enzyme reaction systems requiring thermostable components

    • Development of heat-resistant biocatalytic modules for continuous processing

    • Coupling with other thermostable enzymes from extremophiles to create novel synthetic pathways

  • Model system for high-temperature structural biology:

    • Platform for studying protein-ligand interactions under extreme conditions

    • Investigation of cofactor chemistry at elevated temperatures

    • Development of crystallization methods optimized for thermophilic proteins

  • Development of biosensors for extreme environments:

    • Creation of cobalamin-based biosensors that can function under harsh conditions

    • Environmental monitoring applications in high-temperature industrial processes

    • Biosensing elements in geothermal or deep-sea exploration

  • Improved cobalamin production processes:

    • Engineering of more efficient vitamin B12 production systems incorporating thermostable enzymes

    • Development of continuous high-temperature fermentation processes

    • Creation of immobilized enzyme systems for industrial cobalamin synthesis

Implementation of these applications would require optimization of expression and purification protocols to achieve economically viable production scales. The recombinant protein's existing properties, including His-tag purification capabilities and established storage conditions , provide a solid foundation for these biotechnological adaptations.

What are the most common challenges in working with recombinant cobS and how can they be overcome?

Researchers working with recombinant Methanopyrus kandleri Cobalamin synthase (cobS) may encounter several challenges due to its thermophilic origin and specialized function. Below are the most common issues and recommended solutions:

  • Protein solubility and aggregation issues:

    • Challenge: Expression in mesophilic hosts like E. coli may result in inclusion body formation or aggregation

    • Solutions:

      • Lower induction temperature (16-20°C) during expression

      • Co-expression with molecular chaperones (GroEL/GroES)

      • Use of solubility-enhancing fusion tags beyond the His-tag

      • Addition of stabilizing compounds (trehalose, glycerol, specific salts) to buffers

  • Maintaining enzymatic activity:

    • Challenge: Loss of activity during purification or storage

    • Solutions:

      • Avoid repeated freeze-thaw cycles as explicitly warned in the product information

      • Store working aliquots at 4°C for up to one week

      • For long-term storage, add glycerol (5-50% final concentration) and store at -20°C/-80°C

      • Use the recommended storage buffer: Tris/PBS-based with 6% Trehalose, pH 8.0

  • Substrate availability and stability:

    • Challenge: Cobalamin precursors are complex molecules that may be difficult to obtain commercially

    • Solutions:

      • Establish collaborations with specialized laboratories producing cobalamin intermediates

      • Develop simplified substrate analogs for initial characterization

      • Implement coupled enzyme systems to generate substrates in situ

  • Assay conditions optimization:

    • Challenge: Standard assay conditions may not reflect the enzyme's native environment

    • Solutions:

      • Conduct activity assays at elevated temperatures (65-95°C)

      • Investigate activity across a range of pH values, considering pH shifts at high temperatures

      • Evaluate metal ion requirements and potential inhibitors

      • Include appropriate controls for non-enzymatic reactions at high temperatures

  • Structural characterization difficulties:

    • Challenge: Obtaining high-resolution structural data can be challenging

    • Solutions:

      • Explore thermophilic crystallization conditions

      • Consider alternative structural approaches (cryo-EM, SAXS)

      • Create stabilized variants through targeted mutations

      • Attempt co-crystallization with substrates or inhibitors

  • Expression yield optimization:

    • Challenge: Low yield of soluble, active protein

    • Solutions:

      • Codon optimization for expression host

      • Screening multiple expression constructs with varying tags/fusion partners

      • Optimization of cell lysis conditions (particularly important for thermophilic proteins)

      • Development of refolding protocols if inclusion bodies are unavoidable

By anticipating these challenges and implementing the suggested solutions, researchers can significantly improve their success in working with this fascinating enzyme from an extremophilic archaeon.

What experimental design considerations are critical for accurate activity assessment of Methanopyrus kandleri cobS?

Designing rigorous experiments for accurately assessing Methanopyrus kandleri cobS activity requires careful consideration of multiple factors, particularly given its thermophilic origin and specialized function:

  • Temperature optimization:

    • M. kandleri is a hyperthermophile growing optimally at temperatures up to 110°C

    • Activity assays should be performed across a temperature range (60-95°C) to determine the optimal temperature

    • Temperature stability of assay components must be verified to distinguish enzyme inactivation from substrate/product degradation

    • Special equipment such as metal block heaters or oil baths may be needed for precise temperature control

  • Buffer system considerations:

    • Select buffers with minimal temperature dependence of pK values (e.g., phosphate buffers)

    • Account for pH shifts with temperature (typically 0.015-0.020 pH units/°C)

    • Pre-warm all reaction components to assay temperature

    • Consider buffer additives that enhance enzyme stability (trehalose, glycerol)

  • Substrate quality and handling:

    • Verify purity of adenosylcobinamide-GDP and lower ligand substrates

    • Establish substrate stability under assay conditions

    • Determine optimal substrate concentrations through Michaelis-Menten kinetics

    • Prepare fresh substrate solutions for each experiment

  • Essential controls:

    • No-enzyme controls to account for non-enzymatic reactions at high temperatures

    • Heat-inactivated enzyme controls (protein denatured by boiling)

    • Substrate-only controls to establish baseline degradation rates

    • Positive controls with well-characterized enzymes when possible

  • Detection method validation:

    • Establish linear detection range for product formation

    • Verify detection method compatibility with high-temperature reaction conditions

    • Consider multiple detection approaches (HPLC, spectrophotometric, fluorescence)

    • Develop appropriate calibration curves using authentic standards

  • Experimental design structure:

    • Employ factorial design to efficiently explore multiple parameters

    • Include technical replicates (minimum triplicate) to assess reproducibility

    • Implement biological replicates using independent enzyme preparations

    • Use appropriate statistical methods for data analysis

  • Time course considerations:

    • Establish linear range of product formation over time

    • Consider product inhibition effects in longer reactions

    • For thermophilic enzymes, account for potential changes in reaction rate as temperature equilibrates

A recommended experimental workflow is presented below:

StageKey ParametersControls/Validations
Temperature optimization65-95°C in 5-10°C incrementsTemperature stability of assay components
pH optimizationpH 6.0-9.0 at optimal temperaturepH meter calibration at relevant temperatures
Substrate kineticsVariable concentrations of both substratesSubstrate stability verification
Time course analysisMultiple time points (0-60 min)Linear product formation verification
Cofactor requirementsMetal ions, potential activatorsMetal chelation controls

Following these guidelines will ensure robust, reproducible measurements of cobS activity under conditions that appropriately reflect its native biochemical context.

How should researchers approach the reconstitution and storage of lyophilized recombinant cobS?

Proper reconstitution and storage of lyophilized recombinant Methanopyrus kandleri Cobalamin synthase (cobS) is critical for maintaining enzyme activity and ensuring experimental reproducibility. Based on the product information from search result and general principles for handling thermophilic enzymes, the following comprehensive protocol is recommended:

Reconstitution Protocol:

  • Pre-reconstitution preparation:

    • Centrifuge the vial containing lyophilized protein briefly to bring contents to the bottom

    • Allow the sealed vial to equilibrate to room temperature before opening

    • Prepare sterile reconstitution buffer freshly (deionized sterile water recommended)

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a protein concentration of 0.1-1.0 mg/mL

    • Gently rotate or invert the vial rather than vortexing to avoid protein denaturation

    • Allow 5-10 minutes for complete dissolution

    • For challenging cases, extend dissolution time at 4°C rather than increasing agitation

  • Post-reconstitution processing:

    • Centrifuge briefly (10,000 × g, 1 minute) to remove any insoluble material

    • For long-term storage, add glycerol to 5-50% final concentration (default recommendation is 50%)

    • Divide into small working aliquots to minimize freeze-thaw cycles

Storage Recommendations:

  • Short-term storage (up to one week):

    • Store working aliquots at 4°C

    • Keep containers tightly sealed to prevent evaporation

    • Avoid exposure to light if possible

  • Long-term storage:

    • Store at -20°C or preferably -80°C

    • Ensure aliquots are small enough for single-use to avoid freeze-thaw cycles

    • Label clearly with protein concentration, buffer composition, and date

  • Critical considerations:

    • Never freeze-thaw repeatedly as this is explicitly not recommended

    • Return unused enzyme to cold storage immediately after use

    • Consider flash-freezing aliquots in liquid nitrogen before transferring to -80°C

Quality Control Measures:

Storage DurationRecommended QC TestAcceptance Criteria
After reconstitutionVisual inspection for clarityClear solution without visible precipitates
Weekly (for 4°C storage)Activity assay>80% of initial activity
Monthly (for -20°C/-80°C)SDS-PAGESingle band at expected molecular weight
Before critical experimentsFull activity characterizationActivity within 20% of reference standard

The recommended storage buffer (Tris/PBS-based with 6% Trehalose, pH 8.0) already contains trehalose as a stabilizing agent, which protects proteins during freeze-thaw transitions and prevents denaturation. The addition of glycerol further enhances this protective effect by preventing ice crystal formation that could damage protein structure.

By following these detailed guidelines, researchers can maximize the usable lifetime of recombinant cobS preparations and ensure consistent experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.