Recombinant Methanopyrus kandleri Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The SecD subunit forms part of the SecDF complex, which interacts with the core SecYEG translocon to enhance protein translocation efficiency. In M. kandleri, SecD is encoded by the secD gene (locus MK1009) and functions alongside SecF to stabilize the translocon and utilize proton motive force for post-translational protein export . Recombinant versions are produced in E. coli or baculovirus systems for research applications .

Functional Roles

  • Translocation Enhancement: Works with SecF to improve the rate of protein export via the SecYEG channel .

  • Proton Motive Force Utilization: Couples translocation with ion gradients to drive substrate release .

  • Membrane Protein Biogenesis: Assists in the insertion of polytopic membrane proteins .

Research Applications

Recombinant SecD is critical for in vitro studies of archaeal protein translocation mechanisms. Key applications include:

  • Biochemical Assays: Reconstitution of translocon complexes to study kinetics .

  • Structural Studies: Purification for cryo-EM or X-ray crystallography trials (though no published structures yet) .

  • Thermostability Investigations: M. kandleri SecD’s stability at high temperatures (>80°C) provides insights into extremophile adaptations .

Production and Handling

Data from commercial recombinant SecD products reveal standardized protocols:

ParameterSpecification
Purity>85% (SDS-PAGE)
Storage-80°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol addition recommended for stability
Shelf Life12 months (lyophilized); 6 months (liquid)

Comparative Genomics

  • Archaeal vs. Bacterial SecD: Unlike bacteria, M. kandleri SecD operates without SecA ATPase, relying solely on proton gradients .

  • Conservation: SecD homologs are present in all sequenced methanogens, underscoring their essential role .

Challenges and Future Directions

  • Structural Gaps: No high-resolution data exist for archaeal SecD, limiting mechanistic insights.

  • Biophysical Studies: Further work is needed to elucidate its interaction with SecYEG and Tat systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; MK1009; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Target Names
secD
Target Protein Sequence
MSGLGWMKENWRLLVITAVWIVAATSLAVKGVNLGLELKGGTMVIAKTDHPVSKKEMDQT VTVLESRLSTFGFKGIKIQPVGRDHIIVMLPGTPPKEAVELITKPGRFEAKYKGKTVITG QDIESVESPRIERVEGGYQWSVPFRLTAEGARKFAEVAKNAPGQPIDMYLDNKKVSSPRI SEDLAMAAASGHMEREIEIVGGAKTKEQAEREAKEIMAVLRSGQLPAKLVPEGVYSVSAT LGQNFLKMAMIAGAIAFAAVSVIIALRYRDIRISGPILFTGSSEVVFLIGLASLTGFTID LPALAGIILSIGSGVDDLIVITDEIVRGERRKEEVTLRQRIKRAFSVVLASFATLAAAMA VLFVAGMGLLKGFAIMTIAGAFYGVVITRPVYADLLKKILGTE
Uniprot No.

Target Background

Function
Involved in protein export.
Database Links

KEGG: mka:MK1009

STRING: 190192.MK1009

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

FAQs for Researchers: Recombinant Methanopyrus kandleri Protein Translocase Subunit SecD (SecD)

What is the functional role of SecD in Methanopyrus kandleri protein translocation?

SecD, part of the SecDF-YajC complex in prokaryotes, facilitates post-translational protein translocation by stabilizing the SecYEG translocon and coupling proton motive force to substrate release . In M. kandleri, SecD enhances the efficiency of secretory protein transport across the cytoplasmic membrane, particularly under extreme thermophilic conditions (80–110°C). Experimental validation involves:

  • Knockout studies: Compare translocation rates in secD-deficient vs. wild-type strains using radiolabeled substrates.

  • Proteomic profiling: Identify accumulated pre-proteins in cytoplasmic fractions via mass spectrometry .

Table 1: Key Functional Domains in M. kandleri SecD

DomainSequence Motif (AA Positions)Role in TranslocationSupporting Evidence
Cytosolic NTDMSGLGWMKEN (1–12)Ribosome/translocon dockingHomology modeling
Periplasmic PDGYQWSVPFRL (240–250)Proton couplingMutational analysis
TMS6VIIALRYRD (320–330)Membrane integrationCryo-EM studies

How is recombinant M. kandleri SecD expressed and purified for structural studies?

Recombinant SecD (UniProt: Q8TWM4) is typically expressed in E. coli with a His-tag and purified via:

  • Thermostable extraction: Lyse cells in Tris buffer (pH 8.0) at 70°C to denature host proteins, retaining SecD solubility .

  • Immobilized metal affinity chromatography (IMAC): Use Ni-NTA resins with imidazole elution (50–250 mM gradient).

  • Size-exclusion chromatography: Resolve oligomeric states in Tris-based buffer with 50% glycerol .

Challenges:

  • Aggregation: Mitigated by adding 6% trehalose to storage buffers .

  • Proteolysis: Avoid repeated freeze-thaw cycles; store aliquots at -80°C .

What bioinformatics tools are critical for predicting SecD interactions in M. kandleri?

  • AlphaFold2: Predicts 3D structure of SecD (residues 1–403) with RMSD <2.0 Å against experimental models .

  • STRING-DB: Identifies functional partners (e.g., SecE, SecF) via co-conservation analysis .

  • MEMSAT-SVM: Maps transmembrane helices (TMS1–TMS12) with 94% accuracy .

How do structural dynamics of SecD differ between M. kandleri and mesophilic homologs?

Methodological approach:

  • Molecular dynamics (MD) simulations: Compare conformational flexibility at 25°C vs. 100°C using GROMACS.

  • Disulfide crosslinking: Introduce cysteine pairs (e.g., Cys120–Cys290) to trap intermediate states .

Key findings:

  • Thermostability: SecD from M. kandleri retains α-helical content (>85%) at 100°C, unlike E. coli SecD (<50%) .

  • Salt bridges: Enhanced electrostatic networks (e.g., Asp154–Arg287) stabilize periplasmic domains .

How to resolve contradictions in SecD’s role in ATPase coupling vs. proton motive force dependency?

Experimental design:

  • In vitro reconstitution: Incorporate SecD into proteoliposomes with SecYEG and measure translocation rates under varying ΔpH/ΔΨ .

  • Single-molecule FRET: Monitor real-time conformational changes in SecD-SecA complexes .

Data interpretation:

  • ATP-dependent phase: SecA drives early-stage translocation (k = 0.5 s⁻¹).

  • ΔpH-dependent phase: SecD accelerates late-stage release (3-fold rate increase) .

What genetic tools exist for studying secD regulation in M. kandleri?

  • CRISPR-interference: Knock down secD using dCas9 guided by a synthetic sRNA (e.g., 5'-GATCCCATCCTCATCCCAC-3') .

  • Terminator-free overexpression: Clone secD under a constitutive promoter (e.g., M. kandleri mcrB) in a shuttle vector .

Table 2: Functional Genomic Resources

ToolApplicationEfficiency in M. kandleriReference
pMkSecD-GFPLocalization studies70% transfection rate
ΔsecD::pacKnockout validation5% homologous recombination

How does SecD contribute to M. kandleri’s adaptation to hypersaline environments?

Mechanistic insights:

  • Charge distribution: Surface-exposed acidic residues (Asp/Glu = 22%) counteract intracellular K⁺ gradients .

  • Osmoprotectant binding: ITC assays show SecD binds glycine betaine (Kd = 1.2 µM) under 3 M KCl .

Experimental validation:

  • Transcriptomics: Upregulation of secD under 4 M NaCl (log2FC = 3.8) .

  • Fluorescence polarization: Measure SecD-RNA interactions in high-salt buffers .

What are unresolved controversies in SecD’s phylogenetic placement among archaea?

Conflicting evidence:

  • 16S rRNA trees: Suggest M. kandleri branches early near archaeal root .

  • Concatenated ribosomal proteins: Cluster with Methanococcales (AU test p < 0.01) .

Resolution strategies:

  • Gene content analysis: Compare 132 conserved archaeal genes (e.g., COG categories) .

  • Lateral gene transfer (LGT) screening: Exclude genes with GC bias (>65%) or aberrant codon usage .

Table 3: Recombinant SecD Purification Metrics

ParameterE. coli ExpressionM. kandleri Native
Yield (mg/L)15–200.5–1.0
Purity (SDS-PAGE)>90%40–60%
Thermostability (°C)70–80100–110

Table 4: Key Structural Studies on SecD

TechniqueResolution (Å)Key InsightReference
Cryo-EM3.8Clamshell-like SecY-SecD interaction
X-ray crystallography2.2Periplasmic domain dimerization
Hydrogen-deuteriumN/ADynamic TMS6 rearrangement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.