Recombinant Methanopyrus kandleri Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Role in Protein Translocation

  • Primary Function: Facilitates efficient translocation of unfolded proteins across the cytoplasmic membrane by stabilizing the SecYE translocon .

  • Proton Motive Force (PMF) Interaction: Enhances the rate of translocation via interactions with the PMF, though its exact mechanism in archaea remains under investigation .

  • Non-Essential but Critical: While not indispensable for translocation per se, SecF significantly improves the efficiency of the process .

Protein Translocation Studies

Recombinant SecF is used to investigate:

  • Mechanisms of Cotranslational vs. Posttranslational Translocation: While archaeal Sec systems lack SecA (absent in M. kandleri), SecF’s role in stabilizing the translocon during PMF-dependent export is a focus .

  • Membrane Protein Biogenesis: Studies on how SecF interacts with the SecYE complex to facilitate insertion of hydrophobic segments into the membrane .

ELISA and Immunological Assays

Commercial ELISA kits (e.g., CSB-CF844835MSI) utilize recombinant SecF for:

  • Antibody Validation: Detecting anti-SecF antibodies in serum or purified samples .

  • Quantitative Protein Analysis: Measuring SecF concentrations in M. kandleri lysates or recombinant preparations .

Evolutionary Conservation

  • Cross-Domain Homology: SecF’s role in enhancing translocation is conserved in bacteria and archaea, despite differences in accessory components like SecA .

Table 1: Amino Acid Sequence Highlights

RegionSequence SnippetFunction
N-terminalMGLFEKYVSNLNRLLILTMVFAVICAGSTLALGVKKGIDLKGGTMVILKTEKDPMembrane anchoring and translocon interaction
C-terminal...SVKVAVPLALVAVSIVVFAIFRKPLLSAAVLGALALDLVDALGLMALTGVPLStabilization of the translocon complex

Table 2: Recombinant Production Parameters

ParameterValueSource
Expression SystemE. coli BL21(DE3)
InductionIPTG (isopropyl-β-D-thiogalactopyranoside)
PurificationNickel affinity chromatography (His-tag)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. If you have a preference, please indicate it in your order notes and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice, please contact us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our protein products is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
secF; MK1008; Protein-export membrane protein SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Target Names
secF
Target Protein Sequence
MGLFEKYVSNLNRLLILTMVFAVICAGSTLALGVKKGIDLKGGTMVILKTEKDPDTVTSE ASRILGVSDVEAIRSSQGDVIVQVPKYLSADDVNKLARAVGGEVESVQTIGPALGRVFWE SVKVAVPLALVAVSIVVFAIFRKPLLSAAVLGALALDLVDALGLMALTGVPLTLASFAGL LMIIGYAVDSNILLSMYTVKRRRVRRVDRAIADSFKTGITMVATTTAAACALFLLSMSEA MFEIAAVVIFGLIADVLNTWIFNAWVIREKIAGR
Uniprot No.

Target Background

Function
Plays a crucial role in protein export.
Database Links

KEGG: mka:MK1008

STRING: 190192.MK1008

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.