Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

The Mtr Complex and Methanogenesis

The Mtr complex (MtrABCDEFGH) plays a crucial role in the CO₂ reduction to methane pathway in methanogenic archaea. Specifically, it catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin . This reaction represents an energy-conserving, sodium-ion translocating step in the methanogenesis pathway .

MtrB's Specific Function

Within the Mtr complex, mtrB functions as a structural component of the central stalk that helps anchor and organize the complex in the membrane. The protein contributes to the formation of a four-helix bundle with other subunits (MtrA, MtrF, and MtrG) that forms the core of the stalk structure . This structural arrangement is critical for proper complex assembly and function.

Functional studies have demonstrated that the Mtr complex couples methyl transfer with vectorial Na⁺ transport through a vitamin B₁₂ derivative (cobamide) as a prosthetic group . While mtrB itself does not directly catalyze the methyl transfer reactions, its structural integrity is essential for the proper functioning of the complex as a whole.

Interaction Network

Protein interaction studies indicate that mtrB works in close association with several other Mtr subunits. According to STRING database analysis, mtrB shows strong functional partnerships with other components of the Mtr complex, particularly mtrA, mtrG, mtrH, mtrC, mtrD, and mtrE, with interaction confidence scores approaching 0.999 . These interactions highlight its integral role within the multisubunit complex.

Expression Systems

Recombinant mtrB protein is commercially produced using several expression systems:

Expression SystemTag TypePuritySource
E. coliN-terminal His>90% (SDS-PAGE)Creative BioMart
BaculovirusDetermined during manufacturing>85% (SDS-PAGE)CUSABIO

The choice of expression system impacts the protein yield, folding, and potential for post-translational modifications. When expressed in E. coli, the protein is typically fused to an N-terminal His-tag to facilitate purification .

Available Product Forms

Commercial recombinant mtrB is available in several forms:

FormBufferConcentrationManufacturer
Lyophilized powderTris/PBS-based, 6% Trehalose, pH 8.0VariesCreative BioMart
LiquidTris-based buffer, 50% glycerolVariesCUSABIO
ELISA kit componentNot specifiedNot specifiedCBM15

The lyophilized powder form requires reconstitution before use, while the liquid form is ready for immediate application in downstream processes.

Reconstitution Protocol

For lyophilized protein, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add 5-50% glycerol (final concentration) for long-term storage

  4. Aliquot and store at -20°C/-80°C

  5. Avoid repeated freeze-thaw cycles

The default final concentration of glycerol recommended by manufacturers is 50% .

Methanogenesis Research

As a component of a key enzyme in methanogenesis, recombinant mtrB is valuable for studying methane production in archaea. Given that methanogenic archaea produce 1 to 2 Gt of methane annually, understanding the mechanisms of methanogenesis has significant implications for climate science and renewable energy research .

Extremophile Adaptations

The study of mtrB from Methanopyrus kandleri, which grows at temperatures up to 110°C, provides insights into protein adaptations to extreme conditions. Unlike many other hyperthermophilic enzymes, the Mtr complex from M. kandleri shows unique adaptations to both hyperthermophilic and halophilic conditions . The high intracellular salinity of M. kandleri (>3 M K⁺) is reflected in the unusual properties of its proteins, including a high ratio of negatively to positively charged residues .

The Complete Mtr Complex

The complete Mtr complex consists of eight subunits (MtrABCDEFGH), with mtrB being just one component. Recent structural studies have revealed that the complex assembles as a trimer with a molecular mass of approximately 430 kDa . The complex features a central Mtr(ABFG)₃ stalk symmetrically flanked by three membrane-spanning MtrCDE globes .

Functional Partners

According to protein interaction analyses, mtrB forms strong functional partnerships with other subunits of the Mtr complex:

PartnerFunctionInteraction Score
mtrGStructural component of central stalk0.999
mtrHCatalyzes methyl transfer from methyl-tetrahydromethanopterin to corrinoid prosthetic group0.999
mtrDMembrane subunit involved in Na⁺ transport0.998
mtrCMembrane subunit involved in Na⁺ transport0.998
mtrEMembrane subunit, forms interface with stalk0.998
mtrAContains cobamide cofactor0.998

These interactions underscore the integrated nature of the Mtr complex and the importance of mtrB in maintaining its structural integrity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mtrB; MK0659; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Target Names
mtrB
Target Protein Sequence
MAIVLIDPESQIAMDAVTGAVAEWSEDVVTLDVMPLYEKVEELEQYVNDMMRAMDPSTTT WGTLPGREGVHETAGFLTNFAHGFVIGTMIVALVAFTLAAVYKLHALRLLGL
Uniprot No.

Target Background

Function
This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This reaction is an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mka:MK0659

STRING: 190192.MK0659

Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How does mtrB contribute to the methanogenesis pathway?

The mtrB protein functions as part of the multisubunit enzyme complex that catalyzes the transfer of a methyl group from methyltetrahydromethanopterin to coenzyme M during methanogenesis. This reaction represents a critical step in the energy conservation pathway of methanogenic archaea. Specifically, the enzyme complex mediates the reaction:

5-methyl-tetrahydromethanopterin + coenzyme M → tetrahydromethanopterin + 2-(methylthio)ethanesulfonate

M. kandleri shares the set of genes implicated in methanogenesis and, in part, its operon organization with other methanogenic archaea such as Methanococcus jannaschii and Methanothermobacter thermoautotrophicum . This conservation of methanogenesis genes across different archaeal methanogens supports the monophyletic nature of this functional group.

What research methods are optimal for purifying recombinant mtrB?

When purifying recombinant mtrB, researchers should consider several key factors related to the hyperthermophilic origin of this protein:

  • Expression System Selection: Given the archaeal origin and hyperthermophilic nature of mtrB, E. coli expression systems may produce insoluble protein. Consider modified strains with enhanced capacity for thermophilic protein expression or archaeal expression systems.

  • Temperature-Adjusted Purification: Maintaining buffer stability at elevated temperatures during purification is essential. Use temperature-resistant buffers and consider performing chromatography steps at elevated temperatures (40-60°C) to maintain native folding.

  • Buffer Optimization: mtrB comes from an organism with high intracellular salinity. Purification buffers should include salts (0.5-1.5M NaCl or KCl) to maintain protein solubility and stability.

  • Storage Conditions: As noted in product information, optimal storage includes 50% glycerol at -20°C for short-term or -80°C for long-term stability .

What is the evolutionary significance of M. kandleri and its mtrB protein?

M. kandleri represents one of the deepest branches in the archaeal domain. Previous phylogenetic analyses based on 16S rRNA initially placed M. kandleri close to the root of the Euryarchaeota without suggesting specific affinity with other archaeal methanogens . Some 16S RNA sequence signatures shared with Crenarchaeota were also observed in M. kandleri.

  • Concatenated alignments of ribosomal proteins

  • Gene content-based trees

This clustering with other methanogens suggests monophyly of this group, contradicting earlier 16S rRNA-based phylogenies. The methyl coenzyme M reductase operon of M. kandleri contains a group of genes unique to archaeal methanogens, further supporting this relationship .

This evolutionary positioning makes mtrB and other M. kandleri proteins valuable subjects for studying the early evolution of methanogenesis and archaeal metabolism.

How does mtrB from M. kandleri compare structurally to homologous proteins in other methanogens?

While direct structural comparison data for mtrB across methanogens is limited in the provided search results, broader genomic analysis reveals important patterns. M. kandleri proteins generally show unusually high content of negatively charged amino acids, which might represent an adaptation to the high intracellular salinity of this organism .

When examining the phyletic patterns of Clusters of Orthologous Groups (COGs) including M. kandleri and other archaea, there is remarkable coherence between the genomes of archaeal methanogens. The three archaeal methanogens (including M. kandleri) share 59 COGs that are not represented in any other archaea or bacteria, comprising a genomic signature of this group .

Table 1: Comparison of Key Methanogenesis Proteins Across Archaeal Species

Protein ComplexM. kandleriM. jannaschiiM. thermoautotrophicumFunctional Significance
mtr operonCompleteCompleteCompleteCore methanogenesis pathway
Methylcoenzyme M reductaseDisjointed genes for α and C subunitsComplete operon with duplicationComplete operon with duplicationTerminal step in methanogenesis
Hydrogenase componentsPresentPresent with duplicationPresent with duplicationHydrogen metabolism

What expression systems are optimal for producing functional recombinant mtrB?

When designing expression systems for recombinant mtrB, researchers should consider several factors specific to this hyperthermophilic archaeal protein:

  • Host Selection: While E. coli remains the most accessible expression system, thermophilic hosts such as Thermus thermophilus may provide better folding environments. If using E. coli, select strains with enhanced capacity for expressing proteins with rare codons (e.g., Rosetta strains).

  • Codon Optimization: M. kandleri has a GC-rich genome , requiring codon optimization for expression in most heterologous systems.

  • Fusion Tags: Consider heat-stable fusion partners that can be purified under denaturing conditions if necessary. The His-tag remains efficient for purification, but SUMO or thioredoxin fusions may improve solubility.

  • Expression Conditions: Inducing expression at elevated temperatures (30-37°C) followed by heat treatment of lysates (60-70°C) can help eliminate host proteins while enriching for thermostable mtrB.

  • Refolding Protocols: If inclusion bodies form, specialized refolding buffers containing osmolytes and archaeal-specific lipids may improve recovery of active protein.

Research indicates that recombinant mtrB has been successfully produced with various tag types, with the specific tag determined during the production process to optimize yield and activity .

How can researchers assess the functional activity of recombinant mtrB?

Assessing the functional activity of recombinant mtrB presents unique challenges due to its role in a multisubunit enzyme complex and its extreme thermophilic nature. Several approaches are recommended:

  • Reconstitution of Enzyme Complex: Full enzymatic activity requires reconstitution of the complete methyltransferase complex. This necessitates co-expression or separate purification and reconstitution of all subunits.

  • Coupled Enzyme Assays: Measuring activity via coupled assays that detect either:

    • Consumption of methyltetrahydromethanopterin

    • Formation of methylated coenzyme M

    • Changes in cofactor redox state

  • Thermostability Assessment: Verify thermal stability through differential scanning fluorimetry or activity retention after heat treatment at temperatures mimicking native conditions (80-100°C).

  • Binding Assays: Surface plasmon resonance or isothermal titration calorimetry to assess binding to other subunits of the methyltransferase complex.

For researchers working with methyltransferase components, lessons might be drawn from studies of related enzymes. For example, F420-dependent methylenetetrahydromethanopterin dehydrogenase (Mtd) from M. jannaschii can be inactivated by oxidation and subsequently reactivated by thioredoxin treatment , suggesting that redox state management is critical when working with methanogenesis enzymes.

How does the absence of thioredoxin in M. kandleri impact mtrB function and methanogenesis?

M. kandleri AV19 is uniquely positioned among methanogens as the only species lacking a recognizable homolog of thioredoxin (Trx) . This absence is particularly significant because:

  • Thioredoxin targets fundamental processes in methane-producing archaea, including methanogenesis enzymes, enabling them to recover from oxidative stress and synchronize cellular processes with the availability of reductants .

  • In other methanogens like M. jannaschii, thioredoxin (Trx1) has been shown to activate methylenetetrahydromethanopterin dehydrogenase following partial deactivation by O2 .

  • The absence of thioredoxin in M. kandleri suggests this organism may employ alternative mechanisms for redox regulation and oxidative stress response.

This unique characteristic raises questions about how M. kandleri maintains redox homeostasis and protects its methanogenesis machinery from oxidative damage. Researchers studying mtrB should consider how this protein's function might be regulated differently in M. kandleri compared to other methanogens with thioredoxin systems.

Table 2: Distribution of Thioredoxin Homologs Among Methanogenic Archaea

Methanogenic ClassAverage Number of Trx HomologsGenome Size Range (Mbp)Metabolic VersatilityExample Species
Deeply rooted (incl. M. kandleri)0-21.24-2.94Limited (H2-dependent)M. kandleri (0), M. jannaschii (2)
Methanococci/Methanobacteria2-41.24-2.94Mostly H2-dependentM. thermautotrophicus
Late-evolving Methanomicrobia4-81.8-5.75Diverse (H2, methanol, methylamines, acetate)Various mesophiles

The distribution pattern suggests that the Trx system may have developed in methanogenic archaea as these organisms faced more oxidizing environments through H2 limitation or O2 exposure . The larger number of Trx homologs in late-evolving methanogens could result from horizontal gene transfer or gene duplication with subsequent diversification.

What methodologies can assess the impact of extreme conditions on mtrB stability and function?

Given M. kandleri's hyperthermophilic nature (growth at 84-110°C) and the extreme conditions of its natural habitat, specialized methodologies are required to assess mtrB stability and function:

  • High-Temperature Activity Assays: Design reaction vessels and buffer systems that maintain integrity at temperatures approaching 100°C. Consider using sealed pressure vessels to prevent buffer evaporation during long incubations.

  • Thermal Unfolding Studies: Employ differential scanning calorimetry with extended temperature ranges (up to 120°C) to determine thermal transition points. Compare these with enzymatic activity loss to correlate structural changes with functional impacts.

  • Pressure Effects Assessment: Given M. kandleri's association with hydrothermal vents, high-pressure bioreactors can simulate native conditions when studying mtrB function.

  • Salt Concentration Impact: Systematically vary salt concentrations (0-2M) to determine optimal conditions reflecting the high intracellular salinity of M. kandleri.

  • Oxidative Stress Response: Although M. kandleri lacks thioredoxin, alternative oxidative stress responses might exist. Researchers can expose purified mtrB to various oxidants (H2O2, CuCl2, Aldrithiol-2) and assess activity recovery mechanisms .

How can genomic and proteomic approaches enhance our understanding of mtrB function?

Integrative approaches combining genomics, proteomics, and biochemistry offer the most comprehensive pathway to understanding mtrB function:

  • Comparative Genomics: Analysis of mtrB gene neighborhoods across methanogenic archaea can reveal conserved functional associations. Previous genomic analyses have shown that M. kandleri shares methanogenesis gene organization with other methanogens, supporting their monophyletic nature .

  • Structural Genomics: Homology modeling based on related methyltransferases can predict mtrB structure, particularly important since experimental structure determination is challenging for membrane-associated proteins from hyperthermophiles.

  • Interactome Analysis: Crosslinking studies coupled with mass spectrometry can identify protein-protein interactions involving mtrB within the methyltransferase complex and potentially with other components of the methanogenesis pathway.

  • Adaptive Evolution Analyses: Comparing mtrB sequences across methanogens from different thermal environments can identify temperature-adaptive mutations. M. kandleri proteins generally show an unusually high content of negatively charged amino acids, potentially as an adaptation to high intracellular salinity .

  • Evolutionary Rate Analysis: Determining whether mtrB is evolving at rates similar to other methanogenesis proteins can provide insights into its evolutionary constraints and functional importance.

What are the implications of mtrB research for understanding ancient metabolic systems?

Research on M. kandleri mtrB has significant implications for understanding early Earth biochemistry and the evolution of metabolic systems:

  • Early Earth Metabolism: As methanogenesis developed before the oxygenation of Earth (approximately 2.5 billion years ago), mtrB represents a component of one of Earth's most ancient metabolic pathways .

  • Archaeal Phylogeny: The positioning of M. kandleri in the archaeal phylogenetic tree provides insights into the early diversification of Archaea. While 16S rRNA studies initially suggested a very deep branching position, genome-level analyses consistently group M. kandleri with other methanogens .

  • Primordial Redox Biochemistry: Understanding how mtrB functions in an organism lacking thioredoxin could provide insights into primordial redox regulation systems that operated in anoxic environments.

  • Extremophile Adaptations: The extreme thermophily of M. kandleri makes its proteins, including mtrB, valuable models for studying molecular adaptations to conditions possibly prevalent on early Earth or present in deep-sea hydrothermal vents.

  • Carbon Cycle Evolution: As methane is a potent greenhouse gas and an end product of anaerobic biodegradation, understanding the evolution and function of methanogenesis enzymes like mtrB contributes to our knowledge of the ancient and modern global carbon cycle .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.