Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit C (mtrC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant mtrC

mtrC is a subunit of the Mtr complex, which enables methanogens to harness energy through sodium motive force during methanogenesis. The recombinant version is typically expressed in E. coli or other heterologous systems, often with an N-terminal His-tag for purification . Key attributes include:

  • Full-length sequence: 1–270 amino acids (O32865) .

  • Host systems: Primarily E. coli or cell-free expression systems .

  • Purity: ≥85% as determined by SDS-PAGE .

Gene and Protein Attributes

AttributeDescriptionSource
Gene namemtrC
Protein length270 amino acids (full-length)
Host expressionE. coli, yeast, or cell-free systems
Post-translational modificationHis-tag for affinity chromatography

Role in Methanogenesis

The Mtr complex couples Na⁺ transport with methyl transfer via a cobamide (vitamin B₁₂ derivative) prosthetic group . mtrC, along with subunits MtrD and MtrE, forms a membrane-spanning "globe" structure that facilitates substrate binding and ion translocation . This subcomplex is flanked by the MtrABFG stalk, which stabilizes the cobamide cofactor .

Adaptation to Extreme Conditions

Methanopyrus kandleri thrives in hydrothermal vents (84–110°C, >1 M ionic strength) . Its mtrC subunit exhibits:

  • High salt tolerance: Stabilized by negatively charged amino acids (e.g., glutamate, glutamine) .

  • Thermal stability: Enhanced by alanine-rich regions and reduced hydrophobicity .

Recombinant Expression Systems

Host SystemPurityNotesSource
E. coli≥85%Full-length, His-tagged
Cell-free≥85%Partial/full-length, no host proteins

Challenges in Purification

  • Oxygen sensitivity: Similar to methyl-coenzyme M reductase (MCR), mtrC’s activity may require anaerobic conditions during purification .

  • Post-translational assembly: Proper folding of the Mtr complex in heterologous systems requires careful optimization .

Biotechnological Relevance

  1. Industrial methanogenesis: Engineering mtrC variants for enhanced Na⁺ coupling efficiency.

  2. Enzyme stability studies: Leveraging M. kandleri’s adaptations to high salt and temperature for biocatalysis.

  3. Structural biology: Cryo-EM models of the Mtr complex inform drug design for methane-related applications .

Research Gaps

  • Catalytic mechanism: Detailed kinetics of methyl transfer and Na⁺ translocation remain unresolved.

  • Orphan genes: Horizontal gene transfer events in M. kandleri may explain unique mtrC features .

Comparative Analysis of mtrC Across Methanogens

SpeciesHost SystemPuritySubunit LengthSource
M. kandleriE. coli≥85%Full (270 aa)
Methanococcus maripaludisE. coli≥85%Partial
Methanocaldococcus jannaschiiE. coli≥85%Partial

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery information, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. The default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Typically, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing that tag.
Synonyms
mtrC; MK0658; Tetrahydromethanopterin S-methyltransferase subunit C; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Target Names
mtrC
Target Protein Sequence
MILRTLLISAVAPGGEEEEVEVAVAISPLKLMTAGLICGILGTAFAWVHPLIPALAVIPV VVWGADAVRRVAGYGLGTGVPSIGFMGLGGGSVAAILAAALSGNTVPAWAAAIIGTVIGA VVGALLGVLDRRVIKMKIPVMERCSTEIVASGTLALICLMAAVAGDFTWSAVYSKVIATG LIAVLWAICAISLLHPFNACLGPSETQERTLWLGAECGSLCTVVAGLATANPVVLLAGAA AWLITFWKFWELTKRDAADVVWTGIVPKGE
Uniprot No.

Target Background

Function
This protein plays a crucial role as part of a complex that facilitates the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process is an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mka:MK0658

STRING: 190192.MK0658

Protein Families
MtrC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit C (mtrC)?

Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit C (mtrC) is a protein subunit of the enzyme complex that catalyzes a key step in methanogenesis. It is encoded by the mtrC gene in M. kandleri, a hyperthermophilic methanogen. The enzyme is classified as EC 2.1.1.86 (N5-methyltetrahydromethanopterin--coenzyme M methyltransferase) and functions as part of the pathway that transfers methyl groups during the production of methane . The full amino acid sequence consists of 270 amino acids with a characteristic membrane-spanning domain containing hydrophobic residues that facilitate its integration into the cell membrane .

How does mtrC differ from the MtrC protein in Shewanella species?

Despite sharing the same abbreviated name, mtrC from Methanopyrus kandleri and MtrC from Shewanella species are functionally and structurally distinct proteins:

FeatureM. kandleri mtrCShewanella MtrC
OrganismMethanopyrus kandleri (archaeon)Shewanella oneidensis (bacterium)
FunctionMethyl transfer in methanogenesisElectron transfer to external redox partners
StructureMembrane-spanning protein without heme groupsDecaheme cytochrome with 10 heme groups
PathwayTetrahydromethanopterin-dependent methanogenesisMTR complex for extracellular respiration
Interaction partnersOther methyltransferase subunitsMtrA and MtrB in the MTR complex

While M. kandleri mtrC participates in methyltransfer reactions essential for methane production in archaea , Shewanella MtrC is part of a biomolecular wire that facilitates electron transfer across the outer membrane for extracellular respiration .

What expression systems are recommended for producing recombinant mtrC?

For successful expression of functional recombinant mtrC from M. kandleri, the following methodological approaches are recommended:

  • Expression host selection: E. coli BL21(DE3) or Rosetta strains are preferred for archaeal protein expression, with codon optimization for the expression host.

  • Vector design: Incorporate a thermostable tag (e.g., His6 tag) that can withstand the purification conditions needed for a protein from a hyperthermophile.

  • Culture conditions: Expression at lower temperatures (16-20°C) after induction often improves folding of archaeal membrane proteins.

  • Membrane protein solubilization: Use of mild detergents (DDM, LDAO) for extraction from membrane fractions.

  • Storage buffer optimization: The protein should be stored in Tris-based buffer with 50% glycerol at -20°C for stability, as indicated in the product specifications .

When designing experiments with the recombinant protein, researchers should verify protein activity before use, as repeated freeze-thaw cycles can reduce functionality.

How can isotope labeling strategies elucidate mtrC's role in methanogenesis pathways?

Isotope labeling techniques provide powerful insights into the mechanistic details of mtrC function in methanogenesis. Recommended methodological approaches include:

  • Deuterium labeling: Cultivate M. kandleri in D2O-containing media to track hydrogen atom transfers during methyl group translocation. Analysis of the resulting clumped isotope signatures can reveal mechanism-specific patterns.

  • 13C-labeled substrates: Supply 13C-labeled methyl donors to trace carbon flow through the methyltransferase reaction catalyzed by mtrC and related subunits.

  • Position-specific isotope analysis: Different methanogenesis pathways exhibit distinct isotope signatures. For instance, methylotrophic and acetoclastic pathways show more negative Δ12CH2D2 values compared to hydrogenotrophic pathways .

  • Isotope fractionation analysis: The following data table illustrates how different methanogenesis pathways can be distinguished based on their isotopic signatures:

Methanogenesis PathwayΔ12CH2D2 (‰)Δ13CH3D (‰)Distinguishing Features
HydrogenotrophicLess negativeVariableH from H2 as primary source
MethylotrophicMore negative (~-52.5)Lower valuesCH3-group transfer dominates
AcetoclasticHighly negativeIntermediateAcetyl-CoA pathway
MethoxydotrophicIntermediate negativeHigher valuesMixed sources (includes CO2 reduction)

When contradictions arise in isotopic data interpretation, as observed in studies with trimethylamine (TMA) substrates, additional controls with D-spiked water can help resolve primary versus secondary isotope effects .

What structural and functional analyses can resolve mechanistic questions about mtrC?

To investigate structure-function relationships of mtrC, researchers should employ these methodological approaches:

When conducting these analyses, researchers should consider the extreme thermophilic nature of M. kandleri (optimal growth at 98°C), which necessitates thermostable assay components.

How do researchers address contradictions in experimental data related to mtrC function?

Contradictions in experimental data regarding methyltransferase function, as seen in methanogenesis studies, can be methodically addressed through:

  • Multi-technique validation: When isotope signature data show unexpected patterns (as seen with TMA and TMA+H2 substrates), employ complementary techniques such as:

    • Enzyme activity assays under varied conditions

    • Metabolic flux analysis with labeled substrates

    • Proteomics to confirm expression levels of pathway components

  • Enzyme-specific characterization: The contradictions observed in methanogenesis pathways may stem from different methyl-transferring enzymes catalyzing seemingly similar reactions. For example, different sets of methyltransferase (MT) enzymes catalyze the reactions from trimethylamine to CH3-SCoM versus from methanol to CH3-SCoM .

  • Controlled substrate availability: Design experiments that can distinguish between parallel pathways by selective substrate limitation or isotope labeling of specific substrates.

  • Time-resolved measurements: Track reaction progression through time-course experiments to identify potential shifts in pathway utilization during growth.

  • Genetic manipulation: Where possible, create knockout or overexpression strains to isolate the contribution of specific enzymes to the observed isotope signatures.

The experimental approach should be tailored to address specific contradictions. For instance, when conflicting isotope signatures are observed between expected and actual methanogenesis pathways, as noted in the case of TMA utilization, additional experiments with D-spiked water can help determine the source of hydrogen atoms in the final methane product .

What are the current limitations in heterologous expression systems for studying mtrC function?

Heterologous expression of M. kandleri mtrC presents several challenges that researchers must address:

  • Thermophilic adaptation: M. kandleri grows optimally at 98°C, and its proteins have evolved specific structural features for stability at high temperatures. Expression in mesophilic hosts may yield improperly folded proteins.

  • Membrane integration: As a membrane protein, mtrC requires specific insertion machinery and lipid environment. Heterologous hosts like E. coli have different membrane composition than archaeal cells.

  • Post-translational modifications: Any archaeal-specific modifications required for activity may be absent in bacterial or eukaryotic expression systems.

  • Complex assembly: mtrC functions as part of a multi-subunit enzyme complex. Co-expression of partner subunits may be necessary for stability and function.

  • Codon bias: The GC-rich genome of M. kandleri results in codon usage patterns that differ from common expression hosts, potentially leading to translational pausing and truncated products.

To overcome these limitations, researchers have developed several strategies:

LimitationRecommended SolutionMethodological Considerations
ThermostabilityUse thermophilic expression hosts (T. thermophilus)Requires specialized growth conditions
Membrane integrationAdd solubilizing tags or express truncated soluble domainsMay alter native function
Complex assemblyCo-expression of multiple subunitsRequires multi-cistronic vectors or co-transformation
Codon biasCodon optimization of synthetic genesBalance optimization with maintaining regulatory elements
Protein foldingExpression at reduced temperatures with chaperone co-expressionExtended induction times needed

A promising approach for studying complex membrane proteins like mtrC is the in vitro assembly strategy demonstrated for the Shewanella MTR complex, where separately purified components spontaneously assembled into functional complexes .

How can researchers engineer mtrC for enhanced experimental utility?

Strategic engineering of recombinant mtrC can significantly enhance its utility for mechanistic studies and biotechnological applications:

  • Site-specific labeling: Introduction of unique cysteine residues at key positions allows for attachment of:

    • Fluorescent probes for FRET studies of conformational changes

    • Spin labels for EPR measurements of local environment

    • Photoreactive crosslinkers to capture transient interactions

  • Domain swapping: Replace segments of mtrC with homologous regions from related methyltransferases to identify determinants of substrate specificity and catalytic efficiency.

  • Creation of soluble variants: Design truncated versions that retain the catalytic domain while removing membrane-spanning regions to facilitate structural studies.

  • Fusion proteins: Develop chimeric constructs with reporter proteins or affinity tags positioned to minimize interference with function:

    • Split fluorescent protein complementation for interaction studies

    • HaloTag or SNAP-tag fusions for covalent immobilization on surfaces

  • Thermostability engineering: Introduce stabilizing mutations that maintain activity at lower temperatures for compatibility with mesophilic host systems.

When engineering mtrC variants, researchers should implement a hierarchical screening approach:

  • Primary screen for expression and solubility

  • Secondary screen for proper folding using circular dichroism

  • Tertiary screen for specific activity compared to wild-type

A modular approach similar to that demonstrated with the Shewanella MtrC:MtrAB complex could potentially be adapted for the M. kandleri methyltransferase complex, enabling mix-and-match studies with engineered subunits.

What controls are essential when studying recombinant mtrC activity?

When designing experiments to investigate recombinant mtrC activity, the following controls are critical for data validation:

  • Negative controls:

    • Inactive enzyme variant (site-directed mutation of catalytic residues)

    • Reaction mixture lacking essential cofactors or substrates

    • Heat-denatured enzyme preparation

    • Empty vector control from expression system

  • Positive controls:

    • Native enzyme complex isolated from M. kandleri when possible

    • Well-characterized related methyltransferase with known activity

    • Established enzymatic reaction with similar detection method

  • Specificity controls:

    • Substrate analogs to confirm binding site specificity

    • Alternative methyl acceptors/donors to confirm pathway specificity

    • Inhibitor panel to characterize active site properties

  • System validation controls:

    • Verification of protein purity by SDS-PAGE and mass spectrometry

    • Confirmation of proper folding via circular dichroism

    • Thermal stability assessment via differential scanning fluorimetry

For experiments involving isotope fractionation, include parallel incubations with different substrate isotopologues to establish baseline fractionation patterns . When contradictions arise in experimental results, systematically varying reaction conditions (temperature, pH, ionic strength) can help identify environmental factors influencing activity.

What techniques can resolve conflicting data about mtrC's role in the methanogenesis pathway?

To resolve conflicting experimental results regarding mtrC's role in methanogenesis, researchers should employ these methodological approaches:

  • Integrated multi-omics:

    • Combine transcriptomics, proteomics, and metabolomics data to track pathway utilization

    • Correlate mtrC expression levels with metabolic flux through different methanogenesis routes

    • Identify potential regulatory factors affecting pathway selection

  • In vivo crosslinking:

    • Perform formaldehyde crosslinking in living cells to capture native interaction partners

    • Use proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of mtrC

    • Compare interaction networks under different growth conditions

  • Single-molecule techniques:

    • Apply FRET to monitor conformational changes during catalysis

    • Use optical tweezers to measure binding forces between mtrC and substrate molecules

    • Employ single-molecule tracking to follow dynamics in membrane environments

  • Biochemical reconstitution:

    • Systematically reconstitute the methyltransferase complex from purified components

    • Test activity with varying subunit compositions

    • Examine effects of lipid composition on complex assembly and function

  • Advanced isotope studies:

    • Position-specific isotope analysis to distinguish between competing pathways

    • Multiple-substituted isotopologues to capture correlated isotope effects

    • Time-resolved isotope incorporation to track reaction intermediates

When addressing contradictions like those observed in trimethylamine metabolism, where clumped isotope signatures don't match expected pathways , researchers should test multiple strains and growth conditions to identify strain-specific adaptations that might explain the observations.

How should researchers design experiments to investigate mtrC's interaction with other methanogenesis proteins?

To systematically characterize interactions between mtrC and other proteins in the methanogenesis pathway, implement these methodological approaches:

  • Binary interaction mapping:

    • Bacterial two-hybrid screening optimized for membrane proteins

    • Split-protein complementation assays (PCA) with survivable reporter proteins

    • Surface plasmon resonance with detergent-solubilized or nanodisc-incorporated mtrC

    • Microscale thermophoresis to measure binding affinities in solution

  • Complex assembly analysis:

    • Blue native PAGE to resolve intact complexes under non-denaturing conditions

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to determine stoichiometry and binding constants

    • Small-angle neutron scattering (SANS) to determine complex architecture

  • Functional interaction studies:

    • Activity assays with reconstituted partial complexes

    • Chemical crosslinking followed by activity measurements

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with peptides derived from interaction regions

  • Structural characterization:

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Cryo-electron microscopy of the assembled complex

    • Solid-state NMR of membrane-embedded complexes

    • Computational docking validated by experimental constraints

The experimental design should include controls for non-specific interactions and validate findings using multiple independent techniques. For membrane proteins like mtrC, careful consideration of the lipid environment is essential, as demonstrated in studies of the Shewanella MTR complex where lipid composition affected complex assembly and electron transfer rates .

What specialized analytical techniques are most informative for studying mtrC catalytic mechanisms?

The following specialized analytical techniques provide unique insights into mtrC catalytic mechanisms:

  • Transient kinetics:

    • Stopped-flow spectroscopy to capture millisecond reaction phases

    • Rapid freeze-quench EPR to trap paramagnetic intermediates

    • Temperature-jump methods to initiate reactions with thermophilic enzymes

    • Continuous-flow ESI-MS to detect short-lived intermediates

  • Spectroscopic methods:

    • MCD (magnetic circular dichroism) to probe electronic states during catalysis

    • FTIR difference spectroscopy to detect subtle conformational changes

    • Resonance Raman spectroscopy to characterize substrate binding

    • EPR spectroscopy to detect radical intermediates

  • Advanced mass spectrometry:

    • HDX-MS (hydrogen-deuterium exchange) to map conformational dynamics

    • Native MS to determine intact complex composition and stoichiometry

    • Ion mobility-MS to analyze conformational distributions

    • Crosslinking-MS to identify residues in close proximity during catalysis

  • Computational methods coupled with experimental validation:

    • QM/MM (quantum mechanics/molecular mechanics) to model reaction energetics

    • Molecular dynamics simulations of substrate binding and product release

    • Machine learning approaches to identify patterns in kinetic data

    • Ancestral sequence reconstruction to infer evolutionary constraints

When applying these techniques to mtrC, researchers must account for its membrane-associated nature and thermophilic origin. For studies involving isotope effects in methanogenesis, precise measurement of position-specific isotope distributions is essential for distinguishing between competing mechanisms .

What methodologies can evaluate the influence of environmental factors on mtrC stability and function?

To systematically assess how environmental factors impact mtrC stability and function, researchers should implement these methodological approaches:

  • Thermal stability analysis:

    • Differential scanning calorimetry (DSC) to determine melting temperature

    • Thermal shift assays using environment-sensitive fluorescent dyes

    • Activity measurements after controlled thermal challenges

    • Circular dichroism spectroscopy to monitor secondary structure unfolding

  • pH-dependent studies:

    • Activity profiling across physiologically relevant pH range

    • pH-dependent structural changes monitored by intrinsic fluorescence

    • Determination of pKa values for catalytic residues using pH-dependent kinetics

    • Hydrogen-deuterium exchange rates at different pH values

  • Salt and pressure effects:

    • Activity assays with varying ionic strength and ion composition

    • Structural stability in high salt conditions using small-angle X-ray scattering

    • High-pressure enzyme kinetics to determine activation volumes

    • Osmolyte effects on protein folding and stability

  • Lipid environment optimization:

    • Reconstitution in liposomes with varying lipid compositions

    • Nanodiscs with defined lipid environments for single-molecule studies

    • Detergent screening for optimal solubilization and activity maintenance

    • Native mass spectrometry to detect specific lipid-protein interactions

The table below summarizes key environmental parameters to investigate for M. kandleri mtrC:

Environmental FactorRelevant RangeAnalytical MethodsExpected Impact
Temperature60-110°CDSC, residual activityNative habitat is hyperthermophilic (98°C optimal)
pH5.5-8.0pH-activity profilingAffects protonation of catalytic residues
Salt concentration1-4MActivity assays, structural stabilityInfluences protein-protein interactions
Pressure1-1000 barHigh-pressure spectroscopyM. kandleri habitat includes deep-sea vents
Redox potential-400 to -100 mVElectrochemical methodsAffects methyl transfer energetics
Lipid compositionArchaeal vs. bacterialReconstitution studiesCritical for membrane protein function

When conducting these analyses, researchers should design experiments that can distinguish between effects on protein stability versus catalytic function, as environmental factors may influence these properties independently.

What emerging technologies could advance our understanding of mtrC function in methanogenesis?

Several cutting-edge technologies show promise for elucidating mtrC function in methanogenesis:

  • CryoEM advances:

    • Time-resolved cryoEM to capture conformational changes during catalysis

    • Microcrystal electron diffraction for structural determination of membrane proteins

    • In situ cellular cryoEM to visualize mtrC in its native membrane context

    • CryoFIB-SEM to analyze membrane protein distribution in intact cells

  • Single-molecule approaches:

    • Single-molecule FRET to track conformational dynamics during catalysis

    • Optical tweezers combined with fluorescence to correlate force and function

    • Nanopore-based single-molecule detection of substrate binding events

    • Super-resolution microscopy to visualize complex assembly in native membranes

  • Synthetic biology tools:

    • Expanded genetic code incorporation of non-canonical amino acids for site-specific probing

    • Cell-free expression systems optimized for thermophilic proteins

    • Genome-engineering tools adapted for archaeal systems

    • Artificial cells with minimal genomes for focused pathway analysis

  • Computational advancements:

    • Machine learning approaches to predict functional effects of mutations

    • AlphaFold-based modeling of protein-protein interactions in the methyltransferase complex

    • Quantum chemistry calculations of methyl transfer energetics

    • Whole-cell metabolic modeling of methanogenesis pathways

  • Advanced isotope techniques:

    • Position-specific isotope ratio MS for mechanism elucidation

    • Multiply-substituted isotopologues analysis for clumped isotope effects

    • Real-time isotope incorporation tracked by NMR

    • Quantum tunneling effects in hydrogen transfer reactions

These emerging approaches can help resolve contradictions in experimental data and provide mechanistic insights at unprecedented resolution.

How might engineered variants of mtrC contribute to biotechnological applications?

Engineered variants of mtrC hold significant potential for various biotechnological applications:

  • Biofuel production:

    • Engineered methyltransferases with altered substrate specificity could enable conversion of non-conventional carbon sources to methane

    • Thermostable variants could improve process efficiency in high-temperature bioreactors

    • Immobilized enzyme systems for continuous methane production

  • Carbon capture technologies:

    • mtrC variants optimized for CO2 reduction pathways

    • Engineered methyltransferase complexes with enhanced catalytic efficiency

    • Hybrid systems combining enzymatic and chemical catalysis for carbon fixation

  • Biosensing applications:

    • mtrC-based biosensors for detecting methyl-containing compounds

    • Reporter systems for monitoring anaerobic digestion processes

    • Environmental sensors for methane detection

  • Synthetic biology platforms:

    • Modular methyltransferase components for designer methanogenesis pathways

    • Orthogonal methyl transfer systems for synthetic metabolism

    • Cell-free methyltransferase systems for controlled methane production

These applications could benefit from engineering approaches demonstrated with the Shewanella MTR complex, where functional complexes were assembled from separately purified components that maintained electron transfer capabilities . Similar modular assembly strategies could be developed for methyltransferase complexes.

A methodical approach to enzyme engineering would include:

  • Structure-guided design of active site variants

  • Directed evolution under selective pressure

  • Computational design of stabilizing mutations

  • High-throughput screening for desired properties

  • In vitro assembly of engineered complexes

The extreme thermostability of M. kandleri proteins provides an excellent starting point for engineering robust biocatalysts for industrial applications.

What interdisciplinary approaches could resolve persistent questions about mtrC mechanism?

Resolving complex questions about mtrC mechanism requires integration of multiple scientific disciplines:

  • Structural biology + computational chemistry:

    • Combine experimental structures with quantum mechanical calculations of reaction coordinates

    • Use molecular dynamics to identify conformational changes coupled to catalysis

    • Apply machine learning to predict functional effects of sequence variations

    • Develop structure-based models of methyl transfer energetics

  • Synthetic chemistry + enzymology:

    • Design substrate analogs and mechanism-based inhibitors

    • Synthesize isotopically labeled substrates for mechanistic studies

    • Create chemical probes for active site mapping

    • Develop artificial cofactors with enhanced properties

  • Systems biology + biophysics:

    • Integrate metabolic flux analysis with structural dynamics studies

    • Correlate transcriptional responses with enzyme conformational states

    • Map epistatic interactions between pathway components

    • Develop predictive models of pathway regulation

  • Environmental microbiology + biochemistry:

    • Compare mtrC function across methanogens from diverse habitats

    • Examine adaptations to extreme environments (temperature, pressure, pH)

    • Study co-evolution of interacting proteins in the methanogenesis pathway

    • Analyze horizontal gene transfer patterns in methyltransferase evolution

  • Isotope geochemistry + enzymology:

    • Connect enzymatic isotope effects to environmental isotope signatures

    • Use naturally occurring isotope patterns to infer dominant methanogenesis pathways

    • Develop enzyme-specific isotopic fingerprints

    • Apply position-specific isotope analysis to resolve contradictions in pathway utilization data

By integrating these diverse approaches, researchers can develop a comprehensive understanding of mtrC function within the broader context of archaeal metabolism and global methane cycling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.