Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit D (mtrD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrD; MK0657; Tetrahydromethanopterin S-methyltransferase subunit D; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Target Names
mtrD
Target Protein Sequence
MDKLIAVLVLITLGSIMVNVGVHYVPVGGAPAAMATATGVGTGTTQLAAGSGLTGLITAA AMSQKPFLVILWNGALGAATMMAITMLVGNFIYVYGVGCPPCSAKVDKDPITGWDQEAYV TPGTEGHGIPTVSFVSGILGGLLGGSGGAMVYYALYKVLGMSAALAGILAMGFFYANAVL ASYNIGGTIEGYHDPKFTRLPKAVVCSLVFGIVASVIAYYLSTLM
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process represents an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mka:MK0657

STRING: 190192.MK0657

Protein Families
MtrD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of mtrD in the Mtr complex?

MtrD serves as an essential structural component of the Mtr complex, which catalyzes a key step in the methanogenesis pathway. Specifically:

The methyl transfer occurs in a two-step process:

  • First half-reaction: Methyl transfer from CH3-H4MPT to cob(I)amide

  • Second half-reaction: Methyl transfer from CH3-cob(III)amide to coenzyme M

What are the structural characteristics of mtrD revealed by recent studies?

Recent high-resolution cryo-EM studies have provided valuable insights into the structural features of mtrD within the Mtr complex:

  • MtrD (D1-D233; 233 amino acids total) was fully resolved in the 2.08 Å resolution cryo-EM structure of the Mtr complex from Methanothermobacter marburgensis .

  • MtrD associates with MtrC and MtrE to form membrane-spanning globes, with three such MtrCDE globes symmetrically flanking the central Mtr(ABFG)3 stalk .

  • The structural data reveals that tetraether glycolipids fill gaps inside the multisubunit complex, suggesting their importance for structural integrity .

  • Putative coenzyme M and Na+ binding sites were identified inside or in a side-pocket of the cytoplasmic cavity formed within the MtrCDE subcomplex .

  • The transmembrane pore, which is likely involved in Na+ transport, appears to be occluded in the cryo-EM map, suggesting that the structure captured represents a specific conformational state of the transport cycle .

How is recombinant mtrD typically expressed and purified for research purposes?

For researchers seeking to work with recombinant mtrD, the following methodological approach is typically employed:

  • Expression System: Recombinant full-length Methanopyrus kandleri mtrD protein is expressed in E. coli with an N-terminal His tag .

  • Construct Design: The expression construct includes the full-length protein (amino acids 1-225) fused to an N-terminal histidine tag to facilitate purification .

  • Purification: While specific purification protocols aren't detailed in the search results, the His tag suggests affinity chromatography (likely Ni-NTA) as the primary purification method.

  • Quality Control: Purity is assessed by SDS-PAGE, with typical preparations achieving greater than 90% purity .

  • Final Form: The purified protein is provided as a lyophilized powder .

ParameterSpecification
Expression hostE. coli
TagN-terminal His tag
Protein LengthFull Length (1-225)
Final FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

What experimental considerations are important when handling recombinant mtrD?

Researchers working with recombinant mtrD should consider the following methodological aspects:

  • Reconstitution Protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage (50% is recommended as default)

  • Storage Conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Stability Considerations:

    • Repeated freezing and thawing should be avoided to maintain protein integrity

    • The protein appears to be stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Experimental Limitations:

    • The protein is explicitly labeled as "Not For Human Consumption"

    • As a recombinant membrane protein expressed in a heterologous system, functional studies may require reconstitution in appropriate membrane mimetics

How does mtrD interact with other subunits in the Mtr complex?

Understanding the interactions between mtrD and other subunits is critical for researchers investigating the structure-function relationship of the Mtr complex:

  • Association with MtrC and MtrE:

    • MtrD forms a membrane-spanning globe with MtrC and MtrE, referred to as the MtrCDE globe

    • Three such MtrCDE globes symmetrically flank the central Mtr(ABFG)3 stalk in the trimeric complex

  • Contribution to Complex Architecture:

    • The 2.08 Å resolution cryo-EM structure reveals that MtrD is an integral part of the membrane-embedded portion of the complex

    • The MtrCDE subcomplex forms a cytoplasmic cavity involved in substrate binding and Na+ transport

  • Interaction with Lipids:

    • Tetraether glycolipids visible in the cryo-EM map fill gaps inside the multisubunit complex, suggesting their importance for stabilizing the interactions between subunits

  • Functional Coupling:

    • While MtrD itself may not directly participate in methyl transfer, its structural association with other subunits is crucial for coupling this process with Na+ transport

    • The conformational changes in the complex likely involve coordinated movements of MtrD relative to other subunits

What role does mtrD play in the Na+ transport mechanism of the Mtr complex?

The sodium transport mechanism is a key aspect of the Mtr complex function, with mtrD playing an important role:

  • Formation of Transport Pathway:

    • MtrD, as part of the MtrCDE subcomplex, contributes to the formation of the transmembrane pore involved in Na+ transport

    • The cytoplasmic cavity formed within MtrCDE has been identified to contain putative Na+ binding sites

  • Conformational Changes:

    • The methyl-transfer-driven Na+ transport is proposed to involve conformational changes in the complex

    • These conformational states are hypothesized to include "inward-facing" and "outward-facing" configurations that facilitate Na+ movement

  • Coupling Mechanism:

    • The proposed mechanism suggests that conformational changes in MtrA (carrying the cobamide cofactor) induce changes in the MtrCDE subcomplex

    • Specifically, strongly attached methyl-cob(III)amide carrying MtrA may induce an inward-facing conformation, allowing Na+ flux into the membrane protein center

    • Conversely, loosely attached MtrA carrying cob(I)amide may induce an outward-facing conformation, facilitating Na+ outflux

  • Structural Features:

    • The transmembrane pore appears occluded in the cryo-EM structure, suggesting that the captured state represents a specific point in the transport cycle

What are the methodological challenges in studying mtrD function in vitro?

Researchers face several methodological challenges when investigating mtrD function:

  • Membrane Protein Expression:

    • As an integral membrane protein, recombinant expression of mtrD presents challenges related to protein folding, membrane insertion, and stability

    • Expression in E. coli has been demonstrated, but optimizing conditions for high-yield functional protein remains challenging

  • Complex Assembly:

    • MtrD functions as part of a multisubunit complex, making it difficult to study in isolation

    • Reconstituting the entire complex for functional studies requires expressing and purifying multiple proteins

  • Hyperthermophilic Origin:

    • The native environment of Methanopyrus kandleri (80-110°C) complicates the design of functional assays at ambient laboratory temperatures

    • Protein stability and activity may be compromised at lower temperatures

  • Structural Analysis:

    • While cryo-EM has successfully determined the structure of the Mtr complex, certain components (like MtrH and the soluble domain of MtrA) were not fully resolved

    • This suggests conformational flexibility or weak associations that complicate structural studies

  • Lipid Environment:

    • The tetraether glycolipids observed in the complex structure suggest the importance of the native lipid environment

    • Reconstituting the appropriate lipid environment for functional studies presents additional challenges

How have cryo-EM techniques contributed to our understanding of mtrD structure?

Cryo-electron microscopy has been instrumental in elucidating the structure of mtrD within the Mtr complex:

  • High-Resolution Structure Determination:

    • The Mtr complex structure was determined at 2.08 Å resolution using Relion

    • After density modification with Phenix, the estimated resolution was improved to 1.99 Å

    • The resolution ranges between 1.9 Å in the core and 2.5 Å in the periphery

  • Sample Preparation Challenges:

    • Multiple approaches were used to prepare samples for cryo-EM analysis, including:

      • Treatment with dimethyl maleic anhydride for complete removal of MtrH

      • Gentle disruption of cells with pseudomurein endopeptidase to prevent loss of MtrH

    • Despite these efforts, certain components (like MtrH) were not visibly resolved in the final maps

  • Data Processing and Model Building:

    • Model building was possible for most of MtrD (D1-D233; 233 amino acids total)

    • The excellent quality of the map allowed detailed visualization of protein structure and associated lipids

  • Technical Parameters:

    • The final model showed good stereochemical quality:

      • 98.5% of residues in favored Ramachandran regions

      • 1.5% in allowed regions

      • 0% outliers

      • B-factors (thermal factors) for the protein ranged from 14.5 to 136.2, with a mean of 52.4

What structural adaptations might enable mtrD to function in hyperthermophilic environments?

Methanopyrus kandleri grows at temperatures of 80-110°C, suggesting its proteins, including mtrD, have specific adaptations for thermostability:

What advanced research questions remain unanswered about mtrD?

Despite recent advances, several important questions about mtrD remain for researchers to explore:

  • Structure-Function Relationship:

    • How do specific residues within mtrD contribute to Na+ transport?

    • What conformational changes occur in mtrD during the catalytic cycle?

  • Evolutionary Aspects:

    • How does mtrD from the hyperthermophile M. kandleri compare to homologs from mesophilic methanogens?

    • What structural features have been conserved or diverged during evolution?

  • Bioenergetic Coupling:

    • What is the stoichiometry of Na+ transport per methyl transfer event?

    • How is the energy from the methyl transfer reaction mechanistically coupled to Na+ transport?

  • Interaction Network:

    • Which specific residues in mtrD interact with other subunits of the complex?

    • How do these interactions change during the catalytic cycle?

  • Applied Research Potential:

    • Can the Na+ pumping mechanism of the Mtr complex, including mtrD, inform the design of synthetic ion transporters?

    • Does mtrD contain unique structural motifs that could be exploited for biotechnological applications?

What methodological approaches are recommended for functional studies of mtrD?

For researchers interested in functional characterization of mtrD, several methodological approaches can be considered:

  • Reconstitution Systems:

    • Proteoliposomes: Reconstituting purified mtrD (alone or with MtrC and MtrE) into liposomes provides a membrane environment for studying its role in Na+ transport

    • Nanodiscs: Small patches of bilayer surrounded by scaffold proteins offer a more controlled and monodisperse system for structural and functional studies

    • Whole complex reconstitution: Incorporating the entire Mtr complex into liposomes allows studying the coupling between methyl transfer and Na+ transport

  • Transport Assays:

    • Na+ flux measurements using fluorescent indicators (e.g., SBFI, CoroNa Green)

    • Isotope tracer studies with 22Na+

    • Membrane potential measurements using voltage-sensitive dyes

  • Mutagenesis Approaches:

    • Site-directed mutagenesis of conserved residues in mtrD to identify those critical for complex assembly or function

    • Creation of chimeric proteins with homologs from other species to identify regions important for thermostability

  • Advanced Structural Methods:

    • Time-resolved cryo-EM to capture different conformational states during the catalytic cycle

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Cross-linking coupled with mass spectrometry to map interaction interfaces

  • Computational Approaches:

    • Molecular dynamics simulations to study conformational dynamics and ion transport

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to investigate energetics of ion binding and transport

How can researchers verify the functional integrity of recombinant mtrD?

Confirming that recombinant mtrD retains its native functional properties is crucial for meaningful research:

  • Structural Integrity Assessments:

    • Circular dichroism spectroscopy to evaluate secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure

    • Limited proteolysis to probe folding quality

  • Membrane Insertion Analysis:

    • Sucrose gradient centrifugation to confirm membrane association

    • Protease protection assays to verify topology

    • Fluorescence quenching experiments to assess exposure of specific residues

  • Complex Assembly Verification:

    • Co-immunoprecipitation with other Mtr subunits

    • Size exclusion chromatography to assess complex formation

    • Blue native PAGE to analyze native protein complexes

  • Functional Reconstitution:

    • Na+ transport assays in proteoliposomes containing reconstituted MtrCDE or the complete Mtr complex

    • Assessment of coupling between methyl transfer and Na+ transport in the reconstituted system

  • Thermal Stability Testing:

    • Differential scanning calorimetry to determine thermal denaturation profiles

    • Activity measurements at different temperatures to establish temperature optima and stability

What roles do cofactors and lipids play in mtrD function?

Understanding the interactions of mtrD with cofactors and lipids provides insights into its functional mechanism:

How can isotopic labeling techniques enhance research on mtrD function?

Isotopic labeling provides powerful tools for investigating the structure and function of mtrD:

  • Structural Studies:

    • Selective isotopic labeling (15N, 13C, 2H) of mtrD for NMR studies of dynamics and interactions

    • Methyl-TROSY NMR to probe dynamics of methyl-bearing side chains in this large membrane protein complex

    • Specific labeling of transmembrane segments for oriented sample solid-state NMR

  • Functional Mechanisms:

    • 13C-labeled methyl groups in tetrahydromethanopterin to track methyl transfer through the complex

    • 22Na+ to directly measure sodium transport rates and stoichiometry

    • Deuterium labeling to investigate kinetic isotope effects in the coupled reaction

  • Protein-Protein Interactions:

    • Selective labeling of specific subunits in the complex for FRET studies

    • Crosslinking with isotopically labeled reagents followed by mass spectrometry to map interaction surfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in conformational changes

  • Bioenergetic Coupling:

    • Simultaneous tracking of methyl transfer (using 13C-labeled substrates) and Na+ transport (using 22Na+) to establish coupling stoichiometry

    • Using isotope effects to probe rate-limiting steps in the coupled reaction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.